you all drove me to this

#plumelife, season two. I’m sure the other parents think I’m crazy when they see me looking for artsy photos to take…

What did you do freshman fall? Lifted, toted, clapped, cheered, hoped. Learned the ropes. Made friends. Live-streamed BOA.

What did you do all winter and spring? Went to see the concert band and the jazz band perform. Drove to and from lessons. Went to see college level jazz and concert band performances. Went to see the Marine Band. Watched DCI making-of and show videos. Watched old in-the-lot videos. Waited.

What did you do all summer? Went to DCI shows. Watched in-the-lot videos. Watched corps live-streams before step-off. Checked scores on DrumScorps. Went to DCI rehearsal days. Made in-the-lot videos. Went to DCI finals. Bought swag. Bonded with my musician.

What are you doing now? Built props. Attended preview shows. Waited for marching season to start. Going to football games to see the band and hanging with the parents. Going to marching contests. Lifting, toting, clapping, cheering, hoping. Praying not to get caught on the field with the last prop when the clock is running. Unloading the trucks when it’s late and you’re beat. Hanging with the boys. Doing that thing we do. Loving just about every minute of it.

Rinse and repeat, now until November. As a wise person said, if your kid isn’t glad you’re there, someone else’s kid is. And your kid might admit it, if you press them.     

So today began with a crazy rushed morning during which I skipped all makeup except lip gloss, ran a brush through my hair just enough to get the rats out and pull it back out of my face, and then drove a good 20 miles over the speed limit to get to work 15 minutes late.

Worked all day pretty much non-stop and then, feeling dead tired and about a hundred years old realized I didn’t have enough time to go home before I had to be at church for choir practice!

So, I just dashed in to a fast food place to at least grab a bite of something to eat, forgetting that I was still wearing a Wonder Woman sticker a co-worker had given me. (We tend to be a bit silly at my office sometimes!)

A little girl in line next to me tugged on my hand and said, “I like your sticker.”

I smiled and thanked her and told her Wonder Woman is my favorite superhero.

She grinned and said, “Mine, too!!”
Then she looked at me really closely and said, in all seriousness, “You know, you really look a lot like Wonder Woman. You should totally be her for Halloween.”

HAHAHAHAHA!!

BEST thing anyone has said to me all day! And I refuse to be bothered by the total inaccuracy of her statement at all. While I’m not really sold on the Halloween idea, I DO now intend to rock this WW sticker at church during practice this evening proudly!!

“I always wanted to be a mental health therapist.  Ever since high school, I’ve enjoyed encouraging people and giving them hope.  But I lost my way.  I got caught in a world of addiction.  I lost ten years of my life to drugs.  I stopped when I became pregnant with my child, but by that time it was too late to go back to school.  I started working as an office manager.  I never completely lost my dream.  But I just put it on a shelf for thirty years.  Then five years ago I to…ok it off the shelf.  I heard a lady in my choir talking about how she enrolled in community college.  I drove there the very next day.  I was so nervous when I filled out the application.  I was so nervous the first day of class.  All the old voices were telling me: ‘You never finish anything.’  But I said ‘fuck you’ to the old voices.  And I started getting A’s.  On my first test, I got the only perfect score in the class.  I graduated at the age of 50.  I got my Masters at 55.  And just last night I completed a mental health first aid course.  I’m so close now.  There’s still fear there.  I used to be afraid of it never happening.  Now I’m afraid of it happening.  The old voices try to come back sometimes.  They tell me: ‘You can rest,’ or ‘You’ve earned a break.’  But I’m not stopping this time.  Somebody out there is waiting for me to finish because they need my help.“

The Most Important Story

I came out to my parents when they discovered gay porn on my computer while I was at my friend Nicole’s house choreographing a hip hop dance.

I was shocked because I thought they already knew but, I got a call when I was like, mid shoulder-brush, from my mother being like, “Where are you?” and I was like “I’m at Nicole’s house!” and she was like, “You need to come home now.” And I went home.

I can’t believe i’m telling this story.

Anyway, I went home after we finished the dance.

She drove me home in her Infiniti SUV and I walked into the house and it’s pitch black, and I just see the like back-lit shadow of my mother in the corner of the kitchen just like…

She brings me down and rather than having a nice “let’s talk about this”, she starts like bringing up, she starts like opening up all the websites and I don’t know what to do and I’m like: “Ew what is that? That’s disgusting!”

Meanwhile I’m like: “Yep Tuesday, yep Wednesday, Thursday I didn’t do anything, and Friday.”

And like my dad comes downstairs in his tighty-whiteys and is like “Bran, If it’s yours, just tell us.”

Well, hold on, hold on.

They found this like weird fax, like a document nobody recognized and I was like:

“Well, obviously someone hacked into our computer!”

And they believed me.

Zodiac Signs as The 1975 lyrics
  • Aquarius: Step into your skin? I'd rather jump in your bones.
  • Pisces: You look famous, let's be friends and portray we possess something important.
  • Aries: And you're the only thing that's going on in my mind, taking over my life a second time.
  • Taurus: You used to have a face straight out of a magazine, now you just look like anyone.
  • Gemini: And if I believe you, would that make it stop, if I told you I need you?
  • Cancer: I searched all day it drove me insane. Where would I be if I was my brain?
  • Leo: Get someone you love? Get someone you need? Fuck that, get money.
  • Virgo: We're all human, we're just like you man. We're sentient, we're something.
  • Libra: But you call me when you're bored and you're playing with yourself.
  • Scorpio: I personify the ‘adolescent on a phone’, speaking like I’m bigger than my body.
  • Sagittarius: I said, hey kids we're all just the same. What a shame.
  • Capricorn: She wears a frown and dressing gown when she lays down.

See this photo? I had to stamp a watermark because it has been spreading around without my knowledge nor my girlfriend’s (The Keith cosplayer in this photo)
It really isn’t okay to take someone’s photo without a source + tampering with it. A photo is just as much of an artwork like a drawing is. It isn’t a simple click of the button. Not when I dished out over 2k to get such a shot like this one.
My girlfriend doesn’t have a tumblr to start off with & if this photo isn’t posted anywhere on social media by EmberJayCosplay or Fricklefracklemarco? I want it removed IMMEDIATELY. 
I don’t mean to burst ANY bubbles, but seeing a low-res of MY photo literally drove me INSANE to the point of where I’m actually posting on Tumblr about it. 

Her and I LOVEEEEEE Klance just as much as the next person. (Talk to us about them & we will never stop.)
But taking photos and reposting them? Is a big no no. 

For now? Let us admire this beauty of a photo. 

Follow us on Social Media for all the Klance goods. 
Keith: EmberJayCosplay
Photo credit: Fricklefracklemarco


Note: YES. I am aware of it being posted on FB. 

Liz’s Party | Peter Parker

Summary: Spiderman shows up at Liz’s party to impress everyone, mostly the reader.

Warning: some spoilers

Pairing: Peter Parker (Spiderman) x reader

Type: Alternative scene (what would have happened if Peter showed up at Liz’s party as Spiderman to impress the reader…)

MASTERLIST

Part Two Here / Part Three Here / Part Four Here / Part Five Here / Part Six Here


It was gym class and Ned was currently holding down Peter’s feet as he did sit ups. Ned had recently found out that Peter was Spiderman and was constantly asking his best friend questions about being an Avenger.

“Hey,” Ned piped up. “Can I be your guy in the chair?”

“What?” Peter whispered, not wanting to be too loud.

“You know there is a guy with a headset telling the other guy where to go. Like if you were stuck or lost somewhere, I could tell you where to go because there would be screens and monitors around me. And I could be your guy in the chair,” Ned pleaded.

“Ned, I don’t need a guy in the chair,” Peter insisted.

“Looking good, Parker,” the gym teacher said. Peter paused momentarily before continuing with his sit ups.

“You see for me it would be…f*ck Thor, marry Iron Man, and kill Hulk,” Betty Brant said from the bleachers.

“What about the Spiderman,” Y/N voice piped up, making all her friends on the bleachers look at her.

“It’s just Spiderman,” Liz shrugged.

“Did you guys see that big security cam on youtube? He fought off four guys!” Peter and Ned watched Y/N as she practically praised the Spiderman.

“Oh my gosh. She’s crushing on Spiderman,” Betty joked.

“No way!”

“Kinda,” Y/N shrugged, a blush creeping up onto her face. Peter glance at Ned then turned his attention back to the group.

“Ugh. Gross. He’s probably like thirty,” Betty said.

“You don’t even know what he looks like. What if he is like seriously burned?” Liz suggested.

“I wouldn’t care. I would still love him for the person he is on the inside,” Y/N replied. “He’s a good man and its obvious he really cares about this city. That is something I really admire about him.”

“Peter knows Spiderman,” Ned blurted. Peter’s mouth dropped open and he turned towards Ned. Everyone in the room went silent and all their eyes were on Peter, even Y/N’s.

“Uh, no I don’t,” Peter said, scrambling to his feet. “No. I-I mean.” He turned and faced Y/N and her friends.

“They’re friends,” Ned added with a smile on his face.

“Yeah, like coach Wilson and Captain America are friends,” Flash teased, now walking over to his rival.

“I-I’ve met him. Yeah, a couple times but its uh…through the Stark internship,” Peter clarified, briefly looking at Y/N. Flash seemed to be enjoying this for a smirk was evident on his face. “Mhmm. Yeah but I am not really suppose to talk about it,” Peter turned around, glaring at Ned.

“Well, that’s awesome,” Flash replied. “Hey, you know what? Maybe you should invite him to Liz’s party.”

“Yeah, I am having people over tonight. You are more than welcome to come,” she smiled.

“You’re having a party,” Ned asked.

“W-Will you be there Y/N?” Peter stuttered. Y/N looked up and nodded her head.

“Y-Yeah. I’m going.” Peter smiled shyly at her.

“Yeah, its gonna be dope. You should totally invite your personal friend Spiderman,” Flash insisted.

“Flash,” Y/N warned. “Leave him alone.”

“Ah come on. He’ll be there,” Flash spat. The bell rang and everyone stood to their feet and made their way towards the door. Peter watched Y/N stand, the two of them briefly met each other’s gaze before she broke it. She walked with her friends out of the gym, Peter’s eyes following her form.

Peter groaned in annoyance and look at Ned. “What are you doing?!?”

“Helping you out,” Ned said. “Did you not hear her? Y/N has a crush on you!” Peter opened his mouth to say something but nothing came. He couldn’t believe his childhood crush had a crush on him…well Spiderman. “Dude, you are an avenger!” Ned said, snapping Peter out of his thoughts. “If any one of us has a chance with Y/N, its you.” 

Y/N and Peter had known each other since grade school and had become pretty close friends. Peter developed his first crush on her but never had the guts to tell her. And here she was, years later, having a crush on Peter’s alter ego. It almost didn’t feel real to Peter. Was he hearing this right? Was she really in love with Spiderman?


That night, May drove Peter and Ned over to Liz’s house. May stopped the car in front of the house and nodded her head. “A house party in the suburbs! Oh, I remember these. I’m kinda jealous.”

“It will be a night to remember,” Ned said with excitement.

“Ned, some hats wear men. You wear that hat!”

“Yeah, it gives me confidence,” Ned grinned.

“This is a mistake,” Peter said, suddenly feeling nauseous. “Hey, let’s just go home.”

“Oh Peter. I know. I know its really hard trying to fit in with all the changes your body is going through,” Peter furrowed his eyebrows. “It’s flowering you.” Peter bit his lip and laughed slightly. 

“Okay, yeah. I’m gonna go,” Peter said, unbuckling his seatbelt. He exited the car, Ned following his actions.

“Peter,” May called. “Have fun.”

“I will,” Peter smiled.

“Bye May,” Ned waved as the car drove away. The two of them turned around and began walking up the sidewalk, towards the house. “Dude, you have the suit, right?” Peter lifted up his arm sleeve and showed him the web shooters and red costume. “This is going to change our lives!”

They entered the house, music blasting in the background and kids walking around with drinks in their hands. “DJ Flash,” the announcer said, making both the boys look over at the Flash operating the music.

“Okay, we are gonna have Spiderman swing in, say you guys are tight and then I get a fist bump or one of those half bro hugs,” Ned whispered to his best friend.

“Can’t believe you guys are at this lame party,” Michelle said, standing next to them.

“But…you’re here too,” Ned insisted.

“Am I?” Michelle walked off.

“Oh my–. Hey guys,” Y/N said. “Cool hat, Ned.”

“Hey Y/N,” Ned said with a silly grin on his face.

“Hey Y/N,” Peter’s voice squeaked.

“I’m glad you guys came,” she smiled. “There is pizza and drinks so go and help yourself.”

“Wow, what a great party,” Peter added with a smile.

“I barely did anything. It was all Liz.” Someone called her name and she turned her head. “Oh, I should go.”

“Yeah,” Peter nodded. She walked away and Ned said goodbye to her.

“Dude! What are you doing? She’s here, spider it up!”

“No. No. No. I can’t. I cannot do this. Spiderman is not a party trick,” Peter said. “Look, I am just gonna…be myself.”

“Peter, no one wants that.”

“Dude,” Peter said hurtfully. He turned to walk away when Flash called out his name on the microphone.

“Parker! What’s up? Hey, where is your pal, Spiderman? Let me guess, in Canada with your imaginary girlfriend?” The crowd laughed and Peter clenched his fists in anger. “That’s not Spiderman. That’s just Ned in a red shirt.”


Somehow, through peer pressure, Peter found himself outside. He disregarded his regular clothing and underneath it was his red and blue Spiderman outfit. He knelt down on the rooftop and gazed down at Liz’s house.

“Hey! What’s up? I am Spiderman,” he whispered to himself as he took off his shirt. “Just thought I would swing by, say hello to my buddy Peter. Oh hey, what’s up Ned? Where is Peter anyways?”

He sighed, looking down at Ned who stood awkwardly in the middle of the room. Peter shook his head.

“I can’t do this.” Peter noticed Y/N walk up to Ned and ask him a question. In response, Ned shrugged and she nodded her head before walking away. As soon as she was out of sight, Ned yanked out his phone and dialed Peter’s number. Peter answered it immediately.

“Peter! Where are you? Y/N’s asking for you,” Ned said, desperately.

“I will be there in a second.”

Peter hung up and gazed down at Y/N’s concerned face. She fiddled with her fingers and her eyes continued to wander around the room. Peter put his mask on and stood to his feet before swinging down.

“Oh sorry,” he apologized to some people. Everyone turned around to look at him and all mouth’s dropped open. He maneuvered his way through the crowd of people until he made it inside. “Sorry, I just gotta…find my friend Peter.”

“Spiderman?” He turned around at the sound of Y/N’s voice. His robotic eyes dilated and his head moved up and down her body. His actions did not go unnoticed by Y/N. “W-What are you doing here?”

“Oh, you know. Peter called me and asked if I could show.”

“No way,” Flash said in disbelief. He pushed past the crowd and soon came face to face with the superhero himself. “You’re really him? Are you really friends with Peter Parker?”

Peter turned his eyes towards Y/N who stood behind Flash. He pushed past his rival and approached her. “Hi,” he said awkwardly.

“Hi,” she smiled.

“What’s your name? Wait. No. Let me guess. Y/N, right?”

“Y-Yeah, how did you know?”

“Peter talks a lot about you,” Spiderman said.

“H-He does?” 

“Spiderman!” He turned around and faced Ned. “Hi! It’s Ned. Remember me?”

“Yeah I do. How are you doing?” He gave Ned his fist bump and the boy nearly collapsed when realizing he was going to be popular for the rest of his life.

“Fine. I’ll let you get back to Y/N. She’s a big fan,” Ned laughed. Peter turned his head and eyed Y/N.

“Really?” He teased and she looked down at her feet. 

“Well, kinda,” she replied, blushing like crazy. 

“Well, I should get going. New York isn’t going to save itself,” Spiderman said.

“Yeah,” Y/N added, dreamily admiring the superhero.

“It was nice to finally meet you. Oh and tell Peter that Mr Stark needs him at the internship at four thirty tomorrow,” Spiderman added. “Can you do that for me?”

Y/N nodded and Spiderman winked at her with his big eyes, making her smile. Spiderman used his web shooters and swung away from the party. He made his way back up to the rooftop when everyone had lost interest and began to change back into his normal clothes.

“I can’t believe he actually showed,” Flash said to Y/N.

“What’s the matter, Flash? Jealous of Peter or of Spiderman?”

TO BE CONTINUED…

2

“Burn them all,” he said. “Burn them in their homes. Burn them in their beds.” Tell me, if your precious Renly commanded you to kill your own father and stand by while thousands of men, women and children burned alive, would you have done it? Would you have kept your oath then? First, I killed the pyromancer. And then when the king turned to flee, I drove my sword into his back. “Burn them all,” he kept saying. “Burn them all.” I don’t think he expected to die. He meant to burn with the rest of us and rise again, reborn as a dragon to turn his enemies to ash. I slit his throat to make sure that didn’t happen.

Innocence [M]

Originally posted by jeonsshi

Pairing: Jimin x Female Reader

Genre: Roommate AU!Smut, You have been warned; this fiction is full of smut.

Words Count : Almost 2,1k

Warnings : [M] for Mature Content, this fiction is pure smut.

Author’s Note: Hi guys admin Sunshine is here, so I’ve asked you guys about smut fiction ideas and then I mixed them up a bit, I hope y’all can enjoy this long sinful fiction


“S-i-x fucking months” You said out loud.

That was true actually. It’s been already six-months since you had sex, you were already horny and your roommate’s existence didn’t help at all. You were like a cat in heat, you wanted to have sex but you didn’t trust anyone about sex, they didn’t know your body—they were not good enough for you. You took a deep sigh, your roommate was at the next room and he was sleeping although it wasn’t that late. You were getting hornier and you couldn’t hold yourself any longer; you started to play with yourself. At first you thought this could be the only solution for your little-horny-problem but you forgot how thin the house’s walls were. 

Keep reading

She’s Gay, Dude

Know Your Name - Mary Lambert // Only a Girl - Gia // Ease My Mind - Hayley Kiyoko // All of Me - Luciana Zogbi // Rude - Madilyn Bailey // Daisy - Zedd // Like Real People Do - Ilia Kate // Paradise Is You - La Roux // Take Me to Church - Ellie Goulding // Closer - Tegan and Sara // Sex - Lauren Aquilina // Rhythm of Love - ukulelemily // Tell Her You Love Her - Echosmith // She Will Be Loved - Dani Shay // Hey Girl - Lady Gaga & Florence Welch // She Keeps Me Warm - Mary Lambert // Let Her Go - Arden Cho // Jenny - Studio Killers // Drove Me Wild - Tegan and Sara // She - Dodie Clark // I Do Adore - Mindy Gledhill // Girls Like Girls - Hayley Kiyoko // Girlfriend - Icona Pop

{8tracks} {Playmoss}

I came 🚶 🚪out to my parents 👪 when they discovered gay porn 👉👌💦💦😩😩😩on my computer 👨‍💻while I was at my friend 👫Nicole’s 👱‍♀️house choreographing 👯👯 a hip hop dance. I was shocked 😦because I thought they already knew 💭💭but I got a call 📞📞when I was like, mid shoulder-brush 💁🏻‍♂️from my mother 👩‍👦being like, “Where are you?” ❓❓and I was like “I’m at Nicole’s house” 🏡🏡and she was like “You need to come home now.” And I went home. Anyway, I went home🏡 after we finished the dance👯. She drove me home in her Infiniti SUV🚗🚗 and I walked🚶 into the house🏡 and it’s pitch black ⚫️, and I just see the like back-lit shadow of my mother in the corner of the kitchen 🍽just like… *angry mom look* 👿She brings me down ⬇️ and rather than having a nice 👍🏻 “let’s talk about this”, 🗣 she starts like bringing up,⬆️ she starts like opening up all the websites and I don’t know what to do 😰😰and I’m like “Ewwww what is that?? 🤢🤢That’s disgusting!1!1!” 🙅‍♂️🙅‍♂️Meanwhile I’m like, “Yep Tuesday📆, yep Wednesday…📆Thursday I didn’t do anything📆, and Friday.” 📆And like my dad 👴🏼comes downstairs in his tighty-whiteys👖 and is like “Bran, if it’s yours, just tell us.” 🗣Well, hold on, hold on… They found this like weird fax, 📠like a document📃📄 nobody recognized 🤔and I was like: ”..Well, oBviously someone hacked 😎into our computer!!”💻 And they believed me.💭💭

A Cinderella Story | 01

Min Yoongi | Fluff | Comedy | Smut | ACS!au | Fratboy!Yoongi | 

word count: 10k+

warnings: cumplay, mutual masturbation, phone sex, tribute, explicit language

❝ Your infatuation with Min Yoongi has to be what is the most exhausting part of your life, and in an attempt to help you get over him your friends convince you to join an online adult chat room. Unbeknownst to you the online freak you’ve been sexting for the better half of a year is your childhood crush. Just how much worst could this situation get? One fated night, a confession gone wrong and a lost phone with an almost laughable amount of nudes on it will tell all.  ❞


Keep reading

5

Happy Sunday! 💓

I’ve been getting a lot of questions about how I make my notes and how I keep everything clear and organized, so I’ve compiled a quick list of some of my habits and tricks that keep my notes in order:

  • Use different coloured pens.
    • Personally, I use black for regular notes; blue or purple for what I consider “side notes” (i.e. extra information, examples, etc.); and red for key terms or concepts that I will need to remember the most. Keeping an organized colour theme helps when you go back to study for the exam, because it is a visual reminder of the least and most important bits of information!
  • Give each highlighter a specific purpose.
    • Depending on the notebook and course, I often switch up my highlighter plans ~ for no particular reason other than to keep myself entertained 😋 But I like to set one colour for, say, Chapter/Sub-unit headers, names, historical dates, etc. That way when your eyes are going quickly through your notes, you can easily locate the beginning or end of a particular topic. And as a very visual person, having a lot of different colours in my notes keeps me focused and less overwhelmed.
  • Make important headers stand out.
    • For me, this usually means a particular colour (like a blue highlighter) or some sort of border around the title. My easy go-to is the bubbly-border shown above. Make it easy on yourself when trying to locate a topic!
  • Print out and tape/glue key tables and diagrams.
    • Obviously this is more work than some people might be interested in, and often depends on the course. These are my pharmacology notes, so I didn’t need to print out so often that it drove me crazy. One way to alleviate this is by planning ahead and leaving space in your notebook for where you want a particular table/diagram to go, and then printing them all at the same time. It’s not for everyone, but I like the option when I know I will have to remember certain diagrams or tables!
  • Don’t try to fill up space.
    • If you end up with a short paragraph or lots of room on the sides, leave it be. The best way to study later on is by going through your notes and adding little extra pieces of information to solidify your understanding. For me, this often means writing definitions in the top margin of my pages… not ideal for neat-ness, but who cares! Your notes are meant to be filled up.
  • Don’t stress about imperfections.
    • If you find yourself hating how big and sloppy your writing has become, move on. The worst thing you can do for yourself is waste time rewriting information you already know. If you need to use white-out, use the white-out; if you need to cross out a word, scribble away! Your notes are your own domain and they do not need to be flawless.

I’m sure I’ll think of more tips and tricks, but that’s all for now. If you have any questions don’t hesitate to ask! We’re all in this together 🤓🤓🤓

Much love xx

Day One Hundred and Twenty-Nine

-A young girl informed her mother that she will be receiving seventy-five Hatchimals and “all of the gift cards in here” for this Christmas. Meeting a clairvoyant, as her wisdom proved her to be, opened a wide world of possibilities. Sadly, this world was quickly closed back up as my oracle at knee-height was carted away from me.

-A pen bent in half to form a ninety-degree angle was found on my counter, without even a trace of an origin. This is the First Sign.

-A young boy rolled up to me on a stellar set of Heelys to confirm the balance of a gift card. This absolute icon inspired me to finally get my skills up to snuff and wear my pair to work.

-I managed to show up to work in a pair of pants with a respectable-sized hole in the seat. Shortly after I arrived, I came to find that my coworker had a similarly shaped and positioned inconvenience themselves. I am deeply grateful that I was able to stop myself before commenting on our matching buttholes and falling down that inescapable rabbit hole.

-A man disputed the price of a movie, requesting I get a manager to do a price check, refusing to budge despite the line growing behind him. After this was resolved and he was proved incorrect, he stationed himself at the end of my lane, explaining to each passing guest the full tale of how my folly had caused the holdup.

-Immigrants are taking our jobs. The wage gap is a myth. Anyone can be rich if they’re not lazy, we live in a misandrist society, and Trump represents everyone’s best interests. Now that only middle-aged white men are still reading this, I would like to ask you all to please stop throwing your items at the conveyor belt or at me.

-As I drove to work, I noted a man leaping and skipping up the street in a very determined manner. Midway through my shift, the same man walked through the store, carrying himself in the same stiff yet exaggerated way. It wasn’t until he stopped dead in his tracks, frozen still, before animatedly starting to walk again that I realize the man was clearly a poorly-programmed NPC. It is hard to believe that all of the work our digital overlords have put into making the reality that is our world simply being a simulation has been entirely unraveled by this one isolated glitch. I now know The Truth and am ready to progress.

-I was very nearly witness to an all-out brawl to the death between a pair of guests, as a woman in her eighties voiced complaints about a man in his sixties’ slow couponing habits, and the man laughed in her face at every word. The most shocking part of all of this was, by far, the fact that I did not get yelled at, myself.

-A young girl picked up a glittery unicorn gift card and told her mom that she needed it, and that if she had it, she could buy anything in the store. This normally would not be so simple, but this keen-eyed youngster knew that this unicorn, like all unicorns; was imbued with a great deal of magic, and could have purchased any item. Luckily, her mother put the card back out of her reach before she could cripple the store’s entire financial security.

IT’S GETTING KINDA HOT IN HERE

*I wrote this with the sun and mars signs in mind*

Aries: It was a cool summer night. “You’re crazy.” I said as you pulled me towards an abandoned building. “Don’t be scared, I just wanna check it out.” We wandered through the decaying concrete, graffiti on every wall possible. I was so scared but I was trying hard not to lose my cool. After all you were absolutely loving this. There was a loud creak and I jumped, grabbing your arm. “Babe calm down, look at me.” You said soothingly, rubbing my shoulders. We made out there in the middle of the building; in the middle of the night. Your kisses enthralling, and for a moment I forgot about everything else. The creak came again but louder, “Okay, fuck this.” You laughed, grabbing my hand and we ran as fast as we could out of there and into the summer air.

Taurus: It was pitch black, our kisses growing more urgent as you fumbled around trying to undo my buttons. “I can’t see anything.” you chuckled. I sparked my lighter and you looked around for a candle, finding one and lighting it with my flame; never taking your eyes off me. You undid my pants quickly with a smirk on your face and threw them dramatically across the room. Your lips finding mine again, making up for the loss of contact. “You are so fucking hot” you whispered, running your hands down my body, a trace of goosebumps forming on my skin. You pushed in slowly, moaning as you felt my heat. You buried your face in my hair I lost all focus. I just held on for dear life as the candlelight flickered erratically on the ceiling.

Gemini: Your bedroom was covered with so many posters I couldn’t see what colour it was painted. You had not one, but two lava lamps, one purple and one orange. We were laying on your floor, listening to Frank Ocean on vinyl, “Sometimes I think about faking my own death, and leaving the parts I don’t like about myself behind.” you said somberly, drawing lazy circles on my stomach with your finger. “Where would you go?” I asked. You propped your head up, your adorable face flushed purple in the light from the lamp. “Anywhere but here,” you said pulling me even closer, “only as long as I could take you with me though.” I ran my finger across your bottom lip and you bit it, we giggled quietly, then sighed. You kissed me so deeply, like an ocean tide that ebbs and flows. We made love, slow love right there on your bedroom floor. Every now and then, when things are quiet, parts of that night come back in flashes when I close my eyes.

Cancer: Snow had been coming down like crazy all day and everybody was staying inside. We had made the heroic journey to the store to get the bare necessities. Popcorn, paprika Pringles and those fruity toffees. Now we were cuddled in an abundance of duvets and pillows watching Spirited Away. “Are you cold?” you asked softly. “No I’m actually really warm.” I said adjusting the pillows behind me. Your eyes shot around the room, you bit your lip as your gaze landed on me. “What?” I asked when I noticed you staring. You grinned, “I’m kinda cold.” I couldn’t help but laugh as I lifted my blanket and pulled you into my cocoon. Your hand slipped under my shirt as you got comfortable. “Oh my god, your hand is freezing.” I shrieked. “Warm me up then.” you teased as you kissed me gently.

Leo: “You are such a goddamn hypocrite, why are you being so possessive?” I yelled at you. “Because I fucking love you!” you screamed even louder. My eyes shot wide as the words left your mouth. I felt like I was about to faint. Like everything I’d known for the past two months had been wrong. I put my hand on my forehead and slowly sat down on the sofa. “Since when?” I asked warily. You sat down next to me, leaving a little space between us, not wanting to scare me away. “Since the day I met you.” you said more gently. I shook my head in confusion. All these months I’d been crushing on you, telling myself I was a fool for thinking you could ever feel the same. “Look, I should go.” you said standing up, I grabbed your arm quickly and pulled you to me. I kissed you with my eyes open, I didn’t believe it but my eyes couldn’t lie. You picked me up and put me in your lap. “We can’t do this.” I whispered into your neck. You grabbed me even tighter, not ready to let me go. “Tell me to stop,” you breathed kissing down my collarbone, your finger toying with the band of my panties, “just tell me to stop.” Your eyes searched mine for an answer. Your finger inching further, grazing down the lace in front. I moaned into your mouth, giving you the answer you needed. The one we both needed.

Virgo: My phone buzzed next to my laptop. It was almost midnight and my chemistry notes were making less sense than ever. “Hi baby.” I half sighed as I answered. “Where are you?” you asked. “On my bed, what’s up?” I could hear your breathing through the phone, “Nothing, just thinkin’ about you. ‘Bout us.” you said cheekily. I closed my eyes as that familiar lightness hit my stomach. “Oh really, what are we doing?” I teased. You half groaned on the other line, “Thinking about your skin, running my tongue up your spine, and swirling it around your-” Now I was the one who moaned. “Can you come pick me up?” I panted. You laughed, “Thought you’d never ask.”

Libra: It was my first birthday in the new city and I was feeling more homesick than ever. You knocked on my door and told me to get dressed while you poured two shots of tequila. You took me on an adventure, stumbling through a regal museum slightly tipsy. I was laughing at this modern piece, you asked why I didn’t get it, I said the shape was a bit funky. From behind you wrapped your arms around my waist, pressing yourself up against me, “I think it’s a quite stimulating.” you whispered with a sly grin, and my entire body shivered. Then you took me to dinner, your eyes staring into mine the whole time and I could hear my heart beating in my ears. It was like moving between worlds, reality changing from hour to hour. I don’t even remember what we talked about, only what I was feeling. We couldn’t even last until desert, our minds running away from us. As soon as I opened the door to my place your lips crashed onto mine, and for the first time that night I felt like I could breathe.

Scorpio: “Do you wanna wrestle?” I asked you with a wicked grin on my face. “I’m not gonna wrestle you.” You said not taking your eyes of the TV. I jumped on you and the Xbox controller went flying. “You asked for it.” You growled as you started fighting me back. I knew I had no chance, I just wanted to get you all fired up. Before I knew it I was on my back, hands pinned down above my head and your strong thighs straddling my torso. “Who’s the winner?” you demanded. “You’re the winner daddy.” I purred, reaching up and biting your lip. Your expression shifted, your eyes going from that watery blue to devilish dark in a split second, and I knew I was in for a ride.

Sagittarius: It was 3 a.m. I knew I had school in the morning but at this point I didn’t care. Cruising around the city in your parents BMW, the bass in the sound system making our blood vibrate. Like it hadn’t been already. We didn’t say anything, we couldn’t. We couldn’t afford to lose control. Then L$D by A$AP Rocky came on. My hands were shaking in my lap, your knuckles white from squeezing the steering wheel so hard. The engine purred as you drove faster, now with a purpose, pulling into the beach parking lot. The car came to an abrupt stop and I couldn’t take this any longer. You moved your seat back as I jumped over the console. You kissed me like you were drowning and I was air. All that tension finally snapping like firecrackers as the music pumped through our bodies. Your strong arms lifted me up and pushed my dress up my thighs, the windows fogging up. I could feel your biceps trembling under the palm of my hand, and thought how could something that felt so right be so wrong?

Capricorn: The whole day had had a weird, electrifying feel to it. Now I knew why. We were standing out there on the balcony, face to face in the middle of the crowd. “Kiss me.” you said nonchalantly. “You kiss me.” I incited. You took a long drag of the joint, gently pressing your lips to mine as you blew the smoke into my mouth. I just stared back at you, blowing the smoke out again calmly, your fingers still caressing the back of my neck. You almost smiled but stopped it midway by biting your lip. I grabbed your shirt and pulled you to me. I kissed you like it was the last time. You pulled back slightly to catch your breath, “Wanna get out of here?”

Aquarius: The night I first met you. I didn’t wanna go out but my friends convinced me. The bar was so packed but somehow I got to the front of the stage. There you were, and that cherry red guitar, in your own world. I remember I couldn’t take my eyes of your fingers when you played. I didn’t even notice you were looking at me until the song was over. You laughed and playfully tugged on your shirt. I didn’t get why but then I noticed we were both wearing the same Led Zeppelin shirt. When the show was over you found me so quickly I knew you had been watching me. “I feel like this was meant to be.” you said leaning up against the bar. I took you in, your knuckles had little cuts on them and your black jeans were splattered with green paint. “I’m not really in the mood to make friends tonight.” I said, taking a sip of my beer. You ran your hand teasingly through that dirty blonde DiCaprio hair, “How ‘bout we just stay strangers then?” I knew I’d already lost this fight. The next thing I remember is literally falling into your foyer, your lips on my neck as I moaned in your ear. You held me so tight, pulling my shirt up ever so slightly just to put your skin on mine. I pushed you down, taking my shirt all they way off while I straddled your hips, and you looked at me like I had just discovered fire. When it was all over you grabbed my face with both your hands, “What’s your name?” you breathed. I smirked as I put my clothes back on, “I thought we were gonna stay strangers.” I was halfway home when I realized that the shirt I was wearing wasn’t mine, it was yours.

Pisces: The record had finished all the way through. That needle scratch sound from the record player filled the silence in the room. I was in your arms, tangled in bedsheets and your sticky bodyparts. You grazing my back lightly with your fingers. “I need to pee.” I said trying untangle myself limb by limb. Your arms tightened around me, “No, you can’t go.” you pouted. I giggled and wiggled around in your embrace. “I have to pee, I’ll be quick.” You pressed your forehead against mine. “Promise?” you said softly. I pecked your lips three times. “I promise.”

  • ily: I love you
  • ilysm: I love you so much
  • icotmpwtdgpomciwamfnhcahhdiwsbittakbigacwiwlmsbfmmblwayaiwlianhaswlyntchnaiwhicbittsaiwhawftdsdmhihsuvaiwithaipbaijslblsommitcotkjlsbmdarthanltatsslbsslouatwaidkwtdailewittdmilytywtiddaafalmdcdihtwailb iiyjtuwhohotftlwfladnraiwlwoshiocatbm: I came out to my parents when they discovered gay porn on my computer while I was at my friend Nicole’s house choreographing a hip hop dance. I was shocked because I thought they already knew but, I got a call when I was like, mid shoulder-brush, from my mother being like, “Where are you?” and I was like “I’m at Nicole’s house!” and she was like, “You need to come home now.” And I went home. I can’t believe i’m telling this story. Anyway, I went home after we finished the dance. She drove me home in her Infiniti SUV and I walked into the house and it’s pitch black, and I just see the like back-lit shadow of my mother in the corner of the kitchen just like…She brings me down and rather than having a nice “let’s talk about this”, she starts like bringing up, she starts like opening up all the websites and I don’t know what to do and I’m like: “Ew what is that? That’s disgusting!” Meanwhile I’m like “Yep Tuesday, yep Wednesday, Thursday I didn’t do anything, and Friday.”And like my dad comes downstairs in his tighty-whiteys and is like “Bran, If it’s yours, just tell us.”Well, hold on, hold on. They found this like weird fax, like a document nobody recognized and I was like: “Well, obviously someone hacked into our computer!” And they believed me.
Riordanverse Characters As Things I’ve Seen/Heard/Said at Work

Grover: That guy who opened his wallet and a bunch of sticks came out

Percy: “If I get hit by a car in the parking lot, will I still get paid?”

Annabeth: “Get back here you Danny Devito looking motherfucker”

Frank: “Have a good boy”

Hazel: That lady who had two alpacas in her pickup truck

Leo: “If you use too much cleaner in the oven it can blow up.” ‘Ok, but how much is that…hypothetically speaking”

Jason: “How many times do I have to get hit in the head before I don’t have to come to work anymore?”

Piper: That delivery person who always asks if they are looking sexy

Nico: *buys his boyfriend a coffee* “wow, cheap first date”

Reyna: “Are you bleeding?” “Yes, but I’m wearing two pairs of gloves so it’s okay.”

Will:”Do you want your receipt?” “No thanks, I can’t read.”

Magnus: That guy who came in at 10:30 at night completely sober without a shirt and only wearing 1 shoe

Samirah:  “If I take a dime out of the leave-a-penny-take-a-penny, does that make me an asshole?” “Yes”

Alex: “Your total is $4.20.” “420?” *whispers* “the weed number”

Hearthstone: I need to wear this jacket at all times…for the aesthetic, Gary.

Blitzen: Those group of guys dressed in neon and drove a group of bright, rainbow jeeps. Referred to as the Brigayde. 

Carter: “Maybe you should do your job better.” “Maybe you should mind your business.”

Sadie:  That person who always wears a unicorn onesie and only comes in after 10 pm. 

Zia: “I am not a white girl. I don’t drink. I have standards”

Walt: “Shrek is my spirit animal”

Apollo: That person who threatened to call the news on us because we wouldn’t give them a discount on gas

Meg: “Please don’t kill moths. Their lives mean more to me than yours”

Calypso: *chugs an entire 16 oz Red Bull in one sitting* “God is dead”

Power Rangers Road Trip Headcanon

- “I’ll drive”

“No, i’ll drive”

“The last time you drove you handed the wheel to me.”

“The last time you drove we got hit by a fucking train.”

“That was one time!!!”

“Trini and Kim are driving hand the keys over”


- The boys are all crammed in the back while Trini and Kim have the front.


- They made the mistake of sticking the food next to Jason and Zack. All the food is gone an hour in.


-“I GOT THE POWER”

“ Zack, can you please sing the song that’s actually playing”

“No can do Cap”


- Kim holds Trinis hand when she drives. The boys tease the two until Kim Break checks them.


- They stop by an old city that Trini used to live in and she shows them a round for a bit


-“I have to pee”

“Jesus Kim, we just stopped. You’re gonna have to wait”

“If you don’t stop the car I will break up with you”

“Pulling over now”


-Trini chucks a drink at a car that cuts them off 3 times within 5 miles


- “Great now we are about get RUNDOWN by a fucking HUMMER cause you thought chucking a drink at them was a good idea.”

“We got hit by a fucking train, a hummer isn’t gonna do shit.”

“NOT THE POINT!!”


- They  get a keychain for every state they cross through


- Billy usually  stays awake with the girls during the night drives. Thats when they roll down the windows and let him play his country music


- They get joining rooms at the motels they stop at. Jason accidentally breaks a waffle maker one morning and they all make a run for it.


- Jason has them Morph and take pictures in every state. He posts the pictures on all the official power rangers social media accounts.
 

- When the Roadtrip is over Kim is so tired from driving that instead of waking them up, She  falls asleep and they all spend the night in the driveway

BTS Reaction To:  Body Worship Kink.

-Request: Hey!! Could you do a bts react to you having a body worship kink?-

Thanks for requesting! I didn’t exactly know whether you meant the reader worships their body, or vice versa, so I wrote different things for different members. Hope you don’t mind!

JIN.

You loving Jin’s body was an understatement. You had an instant urge to kiss every inch of his body whenever the both of you were intimate, although whenever you had showed him your love for his body by trailing kisses down his chest, or sucking at his collar bones, he, most of the time, grew impatient.

“No teasing. I don’t want to have to punish you.”

Originally posted by heyexcusemeee

SUGA.

Yoongi liked to worship your body instead of you showing your love for his. Although body worship was seen as a more submissive act, Yoongi loved teasing you by peppering kisses down your breasts as it left you begging for him to go further.

“Mm, who does this body belong to?” He asked, still continuing to leave kisses down your body.

“You, Yoongi.”

Yoongi smirked, looking up at you, noticing how flustered and red you looked under his touch.

“Damn right. All mine..”

Originally posted by totallyyehet

RAP MONSTER.

Like Yoongi, Namjoon liked to worship your body, but that didn’t mean he disliked you showing your appreciation for his body either. He felt somewhat powerful as he watched you roam your hands around his body, your finger tips lightly touching his stomach, as you parted your lips and leaned down to suck at Namjoon’s neck. He loved knowing that you wanted to please him, and him only.

As you worked your way down his body, you kissed Namjoon’s abdomen, causing him to let out a sigh in desperation, but no matter how much he wanted you to take him in your mouth, he was not one to beg, so instead he ordered you to do what he wanted.

“Come on, baby, take Daddy’s cock in your mouth like a good girl.”

Originally posted by https-km

J HOPE.

Hoseok whispered into your ear how much he loved your body, telling you that every single detail tattooed on your skin was perfect to him.

Hoseok had a thing for your collar bones, leaving sloppy kisses on them at every chance he got. You always arched your back at the feeling, threading your fingers through his hair.

“You’re so fucking beautiful.”

Originally posted by hobiinight

V.

“God, I don’t deserve you.” Taehyung softly spoke into your ear which sent shivers down your spine. Taehyung (again, like most of the members) loved to show you how much he adored your body. There was nothing he disliked about your body, finding every part of you extremely attractive. Taehyung mentioned multiple things he loved about you, but he payed most of his attention to your neck, leaving love bites against your soft skin.

“I don’t want you covering these up. I want people to know you belong to me.”

Originally posted by theholyshiteu

JIMIN.

“So perfect, (Y/n)… All for me.”

Jimin loved telling you how your exposed body drove him absolutely insane. He didn’t shower you in compliments just to get you off, but purely because he really and truly thought those things about you. Jimin loved your body, and he wanted to make sure you knew that.

Jimin used his tongue to lightly trail against your left breast, soon moving his tongue over your sensitive nipple. You gasped at this, enjoying the feeling of his wet tongue exploring your chest.

“You’re so gorgeous.”

Originally posted by jiminwhyyougotnojams

JUNGKOOK.

Jungkook loved the feeling of your lips softly kissing the abs on his stomach. He loved the way you showed your appreciation for his body, be it you leaving hickeys on his body, or by letting your hands explore him. But, he especially loved leaving his mark on your body, gently nibbling on the soft skin of your breasts.

“Kitten, you’re absolutely stunning.. God, I love everything about you.”

Originally posted by jeonsshi

Distance

Requested By: @purelyparker

hi there :-) i love your writing sm so i was wondering if you could write a tom holland imagine based off of the song “give me love” by ed sheeran where the reader breaks up with tom bc of his hectic acting schedule but they both aren’t taking the breakup very well (however THERES A HAPPY ENDING?? HOPEFULLY???) but that’s just an idea; it’s totally up to you to put your own spin on it or go in a different direction !! thank you SOSO much🤗💛

Pairing: Tom Holland x Reader

Description: Tom had been traveling a lot lately, so much to the point you rarely saw him at all, sure you’d call and text occasionally, but that wasn’t enough, you supported his acting career 100%, but you couldn’t take it anymore.

Warnings: Kinda sad, slight mention of alcohol, but then happiness :)

Word Count: 2,661

A/N: This actually turned out a lot better than I thought it was going to tbh, so I hope you enjoy it :)) Also, this gif has nothing to do with the imagine, I just thought it was a cute gif of Tom, oops.

Originally posted by ridreyrholland

It had been two months since you last seen Tom, he was off filming for Spider-Man Homecoming, which you totally understood, it took dedication and time, but so did your relationship with him.

Normally when he went off and filmed movies you two were okay, you didn’t normally have issues and you’d still see him and talk almost everyday, but this time it was different.

Tom just disappeared, you’d get an occasional text here and there, sometimes a phone call, but that was it.

You were left in the dark, just like a fan was.

It’s not that you didn’t love his fans, you did with all your heart, they were half the reason you were still sane, since they seemed to have more knowledge about Tom than you did yourself, and you were the one dating him.

You spent those long two months trying to decide on what to do, on what you thought was right and necessary, or more so healthy.

You knew deep down this relationship with Tom was fading, it was becoming stressful and making you more and more upset as the days went by.

‘Cause lately I’ve been waking up alone,

Pain splattered teardrops on my shirt.

Every morning you’d wake up, in hope of a good morning text, literally anything to show that maybe, just maybe he remembered you, but there was never anything.

This crushed your heart, everyday.

Until one day you had enough, you didn’t want to do this, but it was for the best, it was the right decision, it was the smart decision, this relationship wasn’t healthy for you anymore.

You started packing your belongings from Tom’s apartment, tears streaming down your face as you packed up boxes of your belongings.

You dreaded leaving his clothes behind that you always wore, but you knew if you took them you’d never let him go, and you needed to, it was for the best you would tell yourself.

You took one last look around his apartment, the one you had been living in for the past year, all the memories you two had created there were slowly being erased.

You let out a choked sob as you picked up the few boxes you had, before closing and locking the apartment door, and off to your new tiny little apartment your parents had gotten you a while back.

It was a few hours away from Tom’s which was good in a small sense, but at the same time your mind was moving at warp speed, unable to process you were moving back into your old apartment.

You arrived at nightfall, pulling your belongings out of your car before entering your tiny living space, you always had the feeling of comfort and safety in your apartment.

Maybe tonight I’ll call ya,

Maybe I should let you go.

You set your boxes on the counter of your kitchen, pulling out your phone, shakily dialing in Tom’s number.

You pressed the phone to your ear hesitantly, hearing it ring a few times before someone picked up.

“Hello?” A voice rung through your apartment, making your knees go weak.

“Hey Tom..” You murmured into the phone, biting your lip nervously, a bad habit you had gotten.

“Oh, hey Y/N! What’s up?” He questioned casually, as if he had no clue in the world how distant he had been with you these past few months.

“I-I uhm..” You stuttered, your heart beating rapidly, as you nervously swallowed, which Tom could hear through the phone.

“Y/N, what’s wrong? Are you okay?” Tom questioned worriedly, making you blink back tears that were daring to fall down your cheeks.

“No.. Tom.. Things aren’t okay.. They haven’t been for a while..” You spoke, voice barely above a whisper, but Tom heard you clear as day, his heart starting to beat quicker.

“Y-Y/N, you’re starting to scare me, what’s going on?” He stammered, he was now sitting down at a table on set.

“Tom..” You started, wiping your hand across your cheeks, tears continuing to fall down them.

“Do you realize how long it’s been since we’ve talked?” You asked, sitting down on a stool in your kitchen, waiting for his answer.

Tom sat there for a minute, puzzled at your question, until he started to realize how he’d been acting, as if you didn’t even exist.

“Y/N, o-oh my god, I’m s-so sorry.” Tom apologized, his eyes wide as he started to put pieces together.

“Tom, just stop, please?” You whimpered out, pinching the bridge of your nose.

“Y/N, p-please don’t do this..” Tom whispered, his voice cracking, he couldn’t bare lose you.

“Tom, this isn’t healthy, I can’t keep living like this..” You whispered, sniffling, your heart hurting the more you spoke.

“I can change, I can fix things, I-I promise..” Tom pleaded, tears starting to brim his eyes.

“Listen, I love you, but.. I-I can’t do this anymore.. I think.. W-We should b-break u-up..” You stuttered, your heart breaking into a million pieces as you spoke the most awful words.

“N-No, Y/N, p-please! N-No! I-I can’t l-lose you.” Tom cried out, tears now falling down his cheeks, but he didn’t even care anymore if anyone saw him.

“I-I’m so sorry..” You whispered, choking back sobs, as you heard Tom letting out his own.

“Y/N, d-don’t do this, p-please..” He continued to plead, only making it worse for the both of you.

“It’s for the best, I love you, goodbye Tom.” You whispered, hanging up before you could hear anymore of his plea’s.

You slowly slid down the stool, leaning back against your counter, letting out strangled sobs, your heart broken into small tiny fragments.

Tom on the other hand was staring at his phone, unable to process what had just happened.

His hands were shaking, tears were streaming down his red cheeks, his hair was a mess from running and tugging on it too many times.

“Hey Tom, we’re ready to shoot the next scene and, -oh, good lord what happened? Are you okay?” The producer asked, seeing Tom’s state wasn’t exactly stable at the current moment.

Tom just stared ahead of him, unable to produce words, all he could think about was you, and how he had let you down, made you feel like you were forgotten, not important to him, when you actually meant the entire world to him.

You were the reason he woke up every morning, the reason he was happy all the time, the reason he was as successful as he was, you were his light, but now you were gone, and now everything was dark.

“Tom, hey man, what’s going on?“ Jacob rushed over, after the producer told him how worried they were about his mental state.

"Buddy, it’s me, talk to me.” Jacob pleaded, looking over Tom and internally cringing at how much of a disaster he looked.

“Y-Y/n, she b-broke up with m-me.” Tom stammered out, looking up at his friend, who had a look of shock on his face.

“Dude, I’m so sorry. What happened?” Jacob asked carefully, not wanting Tom to have a emotional breakdown even worse.

“I became distant, without even realizing it, and it broke her.” Tom wiped his face, looking at the table sadly.

“You can win her back buddy, I know it.” Jacob tried to convince him, anything to make him lighten up just the tiniest bit.

“I really blew it Jacob, you should of heard her, she sounded so broken, and a-alone and it’s all m-my fault! I made the only person I loved leave me all because I was too much of an idiot.” Tom spoke furiously, hitting the table, startling Jacob.

“Alright, you know what lets just take a break today, you can chill and do what you need to, and we can figure this all out.” Jacob suggested, as Tom nodded slightly, before Jacob went to the producer, who agreed it was a good idea.

Two days passed and you were a total mess, you refused to leave your apartment, your friends tried calling and texting you, but you just ignored them, wanting to be alone.

You just laid in your bed, the curtains closed, a candle lit on your kitchen counter, making your apartment smell like crisp fall air.

‘Cause lately I’ve been craving more,

And it’s been a while, but I still feel the same,

After my blood turns into alcohol,

All I want is the taste that your lips allow.

Without Tom you didn’t know what to do with your life, he was such a huge part of you and now he was missing, a chunk of you was missing and you were lost.

You tried drinking, to numb the pain, but nothing worked, it just made you even more miserable than before.

You needed him.

And he needed you.

The producer had allowed Tom and Jacob to return back home for a few days to figure things out, once he got to his apartment he had expected you to still be there, but once he entered he noticed that none of your belongings were there anymore, and the shirts you once wore were folded on his bed.

In that moment he felt his heart drop, you really had left.

“Dude, where could she be?” Jacob questioned, as they set their belongings in his apartment.

“She returned back to her old one, she used to live there until she moved in with me.” Tom replied, grabbing his keys as they both headed out the door again.

They drove the few hours to your apartment, Tom was a nervous wreck, he wasn’t sure how you’d react to seeing him after all this time.

“Okay buddy, you got this, I’ll wait in the car.” Jacob gave a small smile, along with a thumbs up as Tom got out and walked up to your apartment door, hesitantly knocking.

When you didn’t answer he got nervous, but he saw your car parked in the driveway so he knew you were home.

This made him worry, he quickly fidgeted to find the spare key you had given him, he swiftly unlocked the door, noticing the darkness of the apartment, and the intense smell of alcohol and a fall scented candle.

“Y/N? Y/N where are you?” Tom shouted, before seeing you laying in your bed, staring blankly into space.

“Shit, Y/N.” Tom rushed over, pulling you into his arms tightly, kissing your head.

“T-Tom?” You mumbled out, blinking rapidly before realizing he wasn’t a figment of your imagination, that you weren’t actually hallucinating him.

“Yes, it’s me.” He whispered, now holding your face in his hands gently.

“It’s really you.” You whispered, tears slipping down your face, you couldn’t believe he came to see you.

“It’s really me babe, I’m so so sorry, for everything.” Tom whispered, caressing your cheek gently with his thumb.

“I missed you.” You whimpered, moving your face more into his hand, while placing your hands on his.

“I missed you too darling, I promise that’ll never happen again.” He kissed your forehead, causing you to close your eyes.

“Please, give me another chance.” He pleaded, making you lock eyes with him, before a small smile appeared on your lips as you gave a slight nod.

Tom’s eyes lit up, his heart racing before his lips met yours, the kiss passionate and full of pent up emotions.

“I love you so much, even when you’re an asshole sometimes.” You laughed slightly, your forehead pressed against his.

“I love you too darling, and I know I can be, but that’s why I have someone like you to keep me in place.” He chuckled, kissing your nose before wrapping his arms around you once again.

You both laid there for a bit, catching up, laughing, smiling, kissing, more talking, more kissing.

You knew you always loved this apartment of yours, because no matter what you always felt safe, and now you realized one of those reasons was because of Tom, he made you feel safe, he made you feel at home, because he was your home.

And always would be, no matter what.

You smiled at Tom who was watching you in amusement, before his phone started ringing.

“Hello?” Tom answered, before a smile formed on his face and laughter escaped his lips.

“Yes Jacob, you can come up now.” Tom laughed, making your eyes widen and laugh along with him.

“You didn’t tell me Jacob was here! Jacob I’m coming!” You shouted, sprinting off the bed and running down the hallway.

“But babe, what about me!” Tom shouted after you, a playful grin on his face as he watched you sprint down the hallway.

“Are you kidding? Jacob all the way!” You teased, a playful smile on your face as you tackled Jacob in a hug, making him loose his balance.

“Nooooo! My smoothie!”