totallyespinosa

hi guys! so it’s the new year heyho and these are my favorite blogs from this year ily all so much and thanks for making my dash less boring x

ooooh & my resolution for 2015 is to make more solid friendships so leave me a message if ya wanna be friends yipeeeee :)

#-C

2nashty4u, 4secondsofsummer, 5secondsof-182, 5secondsoftexting, 5sos-writing, acidcxlum, addictedtotroyeboy, ahoybros, ahscircus, alfiesugg, alltimelowkeyhate, alltxmecalum, arielerin5, asslikeespinosa, asslikegilinsky, asslikemattfacelikegilinsky, awharrys, baesiccashton, bananatris, bartsmoneyteam, bbeautiful-burrito, bitchsides, blinking-lights-and-dialtones, blowjacks, blownialls, blvckxdiamonds, bradleyaddicted, bradleyaddicted, bradleys-simpson, bradleysboo, bradleyy, bronnors, callingmendes, calumfood, calxmmxxii, camsfave, camsqueen7, caniffism, clifordless, cliquegilinsky, cloudyashton, confusedirwin, connorcuddles, cuddlingmendes, cutebrads

D-G

daddywilkinson, daily-grier, dailyfanbased, dallasslays, damnjackjack, devil-in-those-eyes, dillonsbandanapants, dillonyupp, disconnectedjacks, doingbieber, doyougotawilkdrummerboy-ash, ejacktion, espi-nosa, espinosarachel, espinosas-cupcake, espinosas-skittles, espinsoa, exileluke, fallenforbands, fallenforbands, fgsbronnor, finervinerboys, freakingomaha, frickdallas, frickmeirwin, fuckboy-5sos, fuckboyjack, geekygrier, gilinskee, gilinskys, gilinskyscum, gilinslutt, gilxnsky, girlinsky, gotharrys, grindlinsky

H-M

hayeshugs, hayesorbye, hayestbh, hella-zoella, hellatronnor, highasjack, hollakenny, homahaboys, hoodsgiggle, hoodswifi, idiothayes, irwinftclifford, jackgilinskywhores, jackjsbae, jacobflopsides, justanothermagconaccount, justencaylen, kennysturbation, kickthesmutsides, kinkygilinskyx, laurenjaurejui lifespinosa, literalnope, lliamsdunbar, lmaomcvey, lukeftcliffordd, magconmadnesss, maloleys, mattsespinosas, mattsgotdabooty, mattswhoreinchurch, moanwilkinson, muffins4mendes

N-S

narreyh, nashty—-grier, nashtymatthew, nashtywilkinson, nobodymendes, noflexniall, omahababes, omahaweed, pantiedropper-gilinsky, peytonsxwyer, pineapplegrier, pizza-n-boys, pottorfff, professorfangirl, radbradley, rayofashtonrightondallas, sammywilkisbae, sammywilkk11, sammywilksprincess, screwyoudallas, shawn-fucking-peter-raul-mendes, shawns-dick, shawnsdarling, shawnsmirk, shawnsmuff, shawnsmuffinshop, shawnstolemymuffin, shut-up-and-nash-me, slaywilkinson, slimshadymendes, smileygrier, smuttyscribbles, snowburry, squats4shawn, staylencloudy, suckingshawn, suckmyasshemmings

T-Z

taydallas, taylorcaniffsluts, taylorcaniffuckyou, taylorcaniffsluts, taylorsgoodvibes, tfiocameron, the-vamps-uk, thedillonrupp, themvinerboys, theofficialdillonrupp, thestarsinourmagcon, those9viners, threesomewithcash, totallyespinosa, tradleyxo, ughviners, unf-wilkinson, whiteslides, wilkindamn, wilkinstud, wilky-baby, withtaylorcaniff96, woahgrier, woahnash, wtfwilkinson, yeetgilinsky, yes-homie, youtube-land, youtube-or-naw, zaynomlinson, zayummbaes

& that’s about it! thanks everyone! looking forward to making more friends this year :) happy new year!

I NOW HAVE 600 CHILDREN

600 bitchez

Dedications:

600: alyssaphoebe02

*to save time, I have just copied and pasted this list from my 500 list, and just added in the new friends i have gained. so if you have received this and isnt following me anymore, follow me. 

-

-bands-are-lifee- -ilyhayes-

#

0hhey-beaautiful 13lil-j0die 1dsecondsofmagcon 3ndl3ss-summ3rr 5-sos-babes 5minutesofsummerblog  5secondsofjohnson 5secondsofmaloley 5secondsoftexting 5sos-daddy 5sosoverwifi 69wilkinson69

A

a-drop-of-kate a-pentaholics-paradise a-problematic-princess aaroncarpenterbae abean874 addsky10 adiellefay afluffywaffle agesinski31301 agraceunknown akacookie alessandrocapitaniguerra aliciasweetpie aliciasweetpie alissa-okay allisoncupcake7 allusernamesichoosearetaken aloha-jacks alyssaphoebe02 alyssaxbauer amberray99 anaelise1 angel-and-a-devil angelicalaidlaw anninhiliation anotherbookobsessedteenager ansleenix6 anvi-s anya-lily15 apaleperspective aquariusbambi apieceofwerk ariannagarrett1113 aristittle asdfghjklcxcxc ash-nuggets ashtonbombxx at-dawn-we-ride-motherfuckers

B

babydollxgilinskyx baby-phoenix babyash1023 babydollhalsey  banapplena bandtubersxtroyler bangingaaron be-immortals beandipp17 beholdthebangs bernadettenordahl bethelifeofmyparty betterthanthiswords bibim00 bieber9469 bigbootychloe blazing-world blue-princessleah bmth1230 boo-to-society booksmusicandsoup bri-gilinsky brianamc1214 briannaweimer brittanyy–nicolee broken-hearts-heal-in-time bruhitsalig buttonbadgesbitches

C

c-dizzle1999 c-jewell-m c-unf  caitlinmaree15 calilifewannabe call-me-a-cutie call-me-jords-pls camdattasstho camgrierbaby cams-girl-megan candlelit-heartbreak caross30 cashewjj cashmash5sos casuallykeenbeard123 ccluber chalupa-batman1 champagnegilinsky chipsrdabae chocolatechipmendes claire-freear clarissavala clawmichael cliffordtattoo coff3e-and-cigarett3s condomq connie-yew cool-sory-bro corpsebreathhades @crazyblondemofo cuddlymxchael curlyfangirl-ninja curious–minds–wonder–alike cutemmings

D

daddy–wilkinson daddys-number-one-failure danielcl1fford datmagcon-squad day-dreaming-galaxies dem-imagines-tho depressedkiss depressedkiss destiiinnymariee destiny01138 dignitydallas diioonnaa123 dillion–hemmings96 dinosaurmattchew dont-wait-until-its-gone dontdoschoolstayindrugs dreamingdallas dreamcatchersns dreamingdallas dreamingintheclouds34 dreamy-luke dunbar09 drunkaaron dynamicmaria

E

eat-tumbrl-sleep-repeat effervescent-forever elegantlydisfunctional ellamarie17 ellisene emilylosee11 emilytypeone eroticmendes euphoricluke erinkgreen espi-nosa evanescentarcadia everythingwillburn99 eye-rolled-hard expojoke  eyebrows-on-gilinsky-tho  ezpinosagirl ezpinosagirl

F

f-a-d-e-d-love fadiphthe fallenaliens fallenangel03998 falll-for-your-type fandompresident fandomsitaly fandomxlifee fearlessjnast farupcalumsass ferir5er fiftyshadesoftheamazingemily findingjoyland flight-the-fight flo118 flowerpowerworld96 fluffballmgc fluffy-aaron fluorescentpizza foodmusicboys frenchmofos fricketyfrackity fuckboycameron fuckmehardergilinsky fudgeflakes fuqthisfuqthat furrystudenttraveler  fvckmemendes 

G

g-i-l-i-n-s-k-y gabbyshack gamergirl205 gangbangedshawn gaozongyang27love gemgem361 giffez gilinskiing gilinskys-stilinski gilinskysbumm gilinskywhiskers gilliansheaa gipepe grace30758 grandexjairegui green-protein greta001 grierismydrug  grindinsky grunge-nations 

H

hakunamatatarhm hanniehoosblog harryfeelstagram hayley1brooke head—-vs—-heart heauxforharry hellanate hemmoodford @hercupcaketaco heyholaoi heyholaoi hhalseyy hmedlock holyvinerss hopesideheaven horan-clifford horanxfood hufflepuffs-heir hulagurlkc97 humaninahumanworld

I

i-am-alpha-now i-am-still-that-little-girl i i-nduratized iamnateslilmama id-rather-b-at-coachella idiut idcviners idkkcalum ilikeantoinette ilikenightwriting ilostmyshoe-79 ilovethoseboys ilove27pears im-a-freaking-penguin imagineblr imaginesfromthemaze imbreakingintopieces impossiblynoisywasteland imtatianakay in-the-endxo  incommonpandabanana ineffable-muke  inktornados invexesi isha286 itsdrea330 itsgilinsexy  itsjustraylene itskimberleymartin itsleviosanotleviosah-godron itstrueloveforthemagconboys iwishthatic0uldwakeupwithamnesia

J

jacielynn97 jackgakaloml jackgilinskisbae jackgilinskysgal jackxgilinskyy jadforever jaimabae jamiedbaker jasmineuribe1 jayc-ee jayskittlesmcguiness jazzyalexandria jewlyann14 jocelynboo143 jordanalexx josieee10 just-anotherprettyface justanotherdumbbandimagineblog justcallmetali justfuckmyurl justkimz12 justmee143 justyoumeanddylan jxmesgrxhxm 

K

kailawashere kaitlynrose14 karoliinaaaah kat1511 katie-dallas-mendes katskrachiz kaylavolkes kayxshelton kayliwaterman kayxshelton keniasupple123  kenziepedersen1 kids-in-the-darkk killer-bitch-101 kitten–muke kiss-my-sass-ya-bisssh kittysizedswift koawalla kuwtomahaboys

L

lanie-is-a-unicorn lastchanceforseconddances laurenmariexo0 lauryntatertot layawayseason letsgodontleavemeplease lexieliz liamprincess lifeofnayeli lifesamesss lifesamesss lilirain lilmuffinmendes lilycordero linley328 lisha-braynt literallyimawkward literalnope littl3d3monicf4eprinc3 little-misunderstood-soul lolaaaaaaaaaaa1d lookingformatt  lovely-mendes lovinmanoli lrhslipring lucy24042 lukeismyfavoriteplace lukeicouldbeyourprincess lukeshemmings 

M

macylux mae-lissa mag-con-boyz magconimaginess mahonefthoodie makaylann5683 makemukesloveaffairrain  maleuhh maliceincandyland malifi50cent maloleyfeels  maloleysmyking maloswilk mamefrown man-tow marvel-ous-heroes matt-on-fire matthewxmagcon mattsgoodvibes mattslipglossaye mazyam mcmaloley meetyourpsychiccom mellowmendes mendesco mendesjacksdallas mendeslover miacali434 miamiihemmings michaelsputa michele-lancaster mickeynov123 midnightmemories014 milly5soslover mirandacoaster miss-rissa967 misshusnaali misswilkinsonbaby moneyweedzayn motherfckinfandoms mrsmlk muffinmyshawn muffins-for-mendes mychaelcliffford myfuckingsummertime mztella

N

naepoohxd nanamonkey156  nashgrier-updates nashgrierisbae1 nashty-but-she-fancy nashtysnowman natasha05000 nate-maloley564 natesass-ets neci-pooh newlifestartnow newtsbebe newtmasbabe nflandnhlauthentic niallersgirlalmighty  nici-like-nikki nikole-larissa16 no-lol-jk no-it-girl nochilljxxe  notoriouschi ntwinzyvy

O

oahis obscuredreams17 ohmyallypinckney ohmymaloley  oliviacunningham5 omaha-beauties omaha-magconsquadup omaha-sos omahaagad omahadamn omahasquad-o2l-magconfessions  omahawildflower omahawilkinsonsgirl omahaparadise omahasquad-af omgtrinn omgtrinn oneofthosecrazygirls16 onlykailyn

P

pac-matt palestclouds parriex1d patrickstumpspants paularocena paustylesxx perks-of-being-a-wallweed perrie96st petersqueaker pimp-daddy-jack pineapple-cashton pizzaandhemmings pladluke pleasgoaway plutophobic polaroidmendes poochfucker popecaniff ppotterheadd pretty-face-darksoul princess3misty princesslilyfaith princesss-sammy purpleluver78

Q

 queenofeverything007 queenopitch9 queenparxdise quxxndom

R

radioactivedxllas radpandachick rainbowcloud123 rap-game-winona-ryder ravenclawinabluebox rbtm10 reachforthestarssx reggae-fest rejected-official remixtaped respirando-unicornios responsiblepenguin reubenstephan rightongilinsky robynhamiltonn roniibear rosegoldlox ryhdndbdjs

S

safetrekapp sammydaddy sammywilkme sandeez96 sanelyinlove sarahcrxss sassysirah savvy-drea sbp0921 scarlett159 scottish-hugs-for-troyler sexpinosaaaa shaishaibae shakircreations shannon134 shannon134 shannonk31 shanzahaider15 shawn-sammy-skate-slut shawnbbymendes shawnmendesstolemyheart shawns-cutie shawns-life-of-the-party shawns-muffin-mendes shawnsdildo shawnsweed shyawn sideways-snapback silly-me-123 sjeagles sk8ergirl9 skatemaloleyislife skinnyminne1 skittlelover103 slayshawn slaywilkinson sleep-and-dance slowlyuniquefan slytherhoesunite smurf5sos smutgilinsky socialkingmaker solkiewicz somethingpoetichere sophialentini sophie-why-not sort-of-pretty-in-pink spencerhood  standandfacetheunknown standgrand17 starbucksgilisnkypost staysmurfy-cx stephanie117101 stonednatee stories-5sos studiodays stuntingjacks suckfienfd summerregi243 supportmendes surrealxteenager sydneychristinap sz3r3tl3k

T

taydallas taylorsbrowneyes taylorsquxxn teal-anchor teenage-nightamre teencrazyandfree tensgirl99 thanksbeto-castiel that-syydkiid thatkid-chopsticks1313 the-url-i-wanted-was-taken-so the-youtuber-phandom theallie1418 thecoolkidz543 thecreepiestfangirl thehookerfromupnorth themadhatterandmarchhare thereisnocure101 theresjust-onlytreehill thorneftwhitesides totallyespinosa tropicalucas those9viners tits-migits totallyespinosa  tropicalucas tropicxldallas troyesgeekygirl troyler-and-zalfie-for-life trulymeblog turnonhappylittlepill twinharlee14 tyler120

U

ughmaloley ughmattx uhalsey ukulelucas ultr-av-iolent um-okay-sophie@ummikus-armastus unholynatemaloley unprofess

V

vacccinates  vintagefringe vinyl-hood vycanonic

W

w22322w wammysilk wellartnevercomesfromhappiness wentredneckcrazy whateverbabeslove  whitesidesbabee whoa-edits whocouldofguessed  why-dididothis wickdbitchofthewest wideeyedhippie  wilkinsonslaugh wilkmygilinsky wishuwerehere1 wnxnhltlwzbjckvlgendbjcg woeitsshana wonderlandlovelove

X

x-handwritten-x xelaalec xxfallenxxo 

Y

ya-might-as-well yami-biersack yasssammywilk yeahimthatgirlhaha  yeshomie yeimikarinaaaa yessomahotties yolo13ya14 youcanbedaddy youtubers-are-life-ruiners

Z

zerbrochenesmeer zestywaterhorse

HAS ANYONE NOTICED?  I am now a 5sos/magcon-omaha blog!

I have many ideas for preferences and fanfictions for the 5sos boys!

Read my newest: “Mad” Jack Gilinsky

love,

Jackie :-)

Ok, so I know this is late, but idc!! This year, I wish everyone the best. I hope you get everything you want; follow every dream you have; succeed at everything you do!! I would like to thank the following blogs for having made this past year one of my best. This is full of mutuals and blogs that I just really love!!

A-C:  aaroncarpentar, ashtonftdrums, assdfghh, asslikemattfacelikegilinskyassquad​, av0nsdallas, bartsmoneyteam, beyoncebeytwice, beyonseh, blowjacks, caldernot, camdattasstho, camdawgdallas, camsfave, caniffism, cashsluts, champagnepadre, chipotlmao, confusedclifford, cuddlymccalls, cuntyhemmo, cussturd

D-I:  daisylongmile, disconnectedjacks, drewsland, electricgrier, espinosasbooty, espinosassy, espinsoa, f-r-u-s-t-a-t-e-d, forevver21, frickmeirwin, fuckboyzayn, fuckingwilk,gilinisky, girlinsky, gotharrys, heartmades, highlukes, holdupmatthew, hollakenny, holymagcon, ibelongwith-you, idiothayes, indikos,

J-M:  jadelust, jennyfromthetrap, kardayeshian, kickthesmutsides, lliamsdunbar, lohanthony, lolgilisky, londonfairy, lordpaynos, lovingmagcon2, lovouto, lunnamoonn, magconchristmas, magconmgmt, makeitrainandletitbe,​ matthews-wifey, mattswhoreinchurchmenduhs, monteiths, musiic-is-lifee

N-S: n-a-s-h-l-y, nashtywilkinson, nicolezai, orhgasm, parydise, pesykink, peytonsxwyer, pineapplegrier, radjcool, rightondallas, serfborts, shawnsdarling, shawnsunshine, smileygrier, suckgilinsky, sunshine-in-rain, suptaylorcaniff, sweethaerts,

T-Z: taydallas, taylorswift, thatnutellagirl, thugshawn, totallyespinosa, twistofpayne, tyleroakley, vanessayves, virgokink, wilkinsonslaugh, withtaylorcaniff96, woahgrier, wtfwilkinson, xaylorswift, yoncey, zavnjmalik, zaynshookah, zeysus, @zoellas

I dedicate the following message to my little sisters pretty-in-puma(shan), luekas(des), and omahoez(nish): I HATE ALL OF YOU! You girls have made this year the best one I’ve had in a long time. I can’t tell you how grateful I am to know that I have you guys in my life. Shan, I’m grateful for all the times that you’ve helped me through rough patches; you really are a true friend. Des, I’m grateful all the times you’ve made me laugh when I was at my worst; and all of the funny videos of you:)).  Nish, I’m grateful for all the fun we used to have pretending to hate each other. All of the pranks we would play on people were great. Guys, all of the moments we shared were priceless because they made me forget the  world around me. I LOVE YOU GUYS SO MUCH

2

this morning i hit my goal of 1K!
so i decided to do a follow forever.
I love all of you so much thankyou😳😁💗

my mains (in no order)
kaytheskittle - OMFG KAYLA I COULD GO ON FOREWR BUT I LOVE YOU AND I CAN TELL YOU YOURE PERFECT FROM HEAD TO TOE💎💍💜

shawnstolemymuffin - sara my baby, you literally have been here since like the start, i remember your old url which is what you changed back to, and i remember when we became besties😉, you mean so much to me and i love you millions and millions honeypie💝💝

daily-grier - KAYLEE YOUR URL CONFUSED ME, COS I FORGOT but holy crap i love you, i followed you for so so long and i fell in love with your imagines. Then i started speaking to you omg youre one of my bestfriends and i can count on you for anything, and youre so pretty😭😭, you and nash are 100000% my otp! i love you to infinity and beyond sweetheart💙💙💙💙

wiild-f0r-the-night - holy shit jane, baby, i love you so much, you always make me smile and i love how youre always here to chat if anything, you mean the world to me and thank you for everything, i love you princess💗

sammywilkmybae - GABRIELA OH LORD HOW I LOVE YOU! You’re my lil cupcake and i love you millions, you’re always there to make me smile and to talk to me, you’ve always been one of my bestfriends on here and i want to thank you for everything babygirl💋

mattchu-espinosa - madison😍😍 oh lawwwdd help me, you’ve been there for me nmw, you make me laugh and smile all the time. You know exactly what to say and i can talk to you all the time, but frfr im the sass queen and i have the throne👑👑 love you💅

ohmyviners and nashtyasgrier
brooke+jess youre my bestfriends and irl youre losers but youre hella rad on here, love yous

daddy-espinosa - ERIN PRINCESS I LOVE YOU AND YOU MAKE ME SMILE AND YOURE SUPER DUPER PRETTY, YOURE PERFECT, YOU ALWAYS MAKE ME SMILE AND I LOVE YOU ALOT💙💙💙

espi-howboutno-sa - LEAH, weve only just started speaking more, but oh god i love you! you’re one of my bestfriends now and youve made my day so many times, you’re stunning😍😍, and i want to say i love you💅💗

aaronseggo - Sophie you da real mvp, you make me smile and ive started talking to you more, youre hella cute and you and aaron are otp, love you bbycakes💋

beccacandy - BECCA I LOVE YOU AND EVERYTHING ABOUT YOU, YOURE A PRINCESS AND MAKE ME SMILE AND I CANT GO INTO DETAIL ABOUT GOW MUCH I LOVE YOU💋💋💋💗

Everyone imma keep following bc youre flawless💅👑

#-A
12boys-imagines 2nashty4u 98flipped a-weed-among-flowers aaroncarpentatata aaroncarpenter1998 aaroncarpenterrr aaronsbaee aaronschapstick aaronsxbaeex accidentallychaotic allysoninwonderland16 alwaysmagcon arghgilinsky attractivegrier ayyegilinsky ayyyee-jayy

B-C
babyespinosalove barakat1818 bartsmoneyteam beaujoblawley bigdickgrier bitchseries bitemedallas blessedespinosa bluecornchip377 buckwildinchurch butgilinsky
camboydallas cameronwilkinson camnashtaylorr camsfave camshair camslutt camsqueen7 caniffdicktoobomb caniffhugs captainlivinginadreamworld cashdarier cashewmendes cashgivesmefeels cashtoxicated chokemegilinsky cliquegilinsky cuddlemewhitesides cuddlememagcon curseofcaylen cus-you-are-my-heaven

D-E
daddywilkinson dafuqashton dallaswut dgrier01 dillonyupp disconnectedjacks doyougotabea dudekianlawleyiskewl eletricgrier emmabella26 espi-nosa espinosa5sos espinosaaron espinosaavenue espinosarachel espinosas-a-babe espinosas-skittles espinosasmatt espinosasunshine espinosaurr espinosaxsmile espinosrawr espinsoa espionsaawiilk espisaurusrexx explicit-gilinsky

F-G
feelingsuckk flowerxchains fluorescentpizza freakmenash fricking-youtubers fuckingviners fuckingwilk fuckmeintheassmatt g00d-vib3zzzzposts gilinskybound gilinskydaddy gilinskysbutternutdude gilinskys-dick gilinskys gilinskysarms girlinsky gotmendes griersthief grinningilinsky guh-linn-skee

H-I
ha-ha-hayes hayesbootay hayeshugs hayeslayesbbq hayesmygrier hayesnostrils hayesoffcial hayess-grierr hayestbh hayeswifeyyyyyy hearteyesespinosa hemmingsluts hickeyspinosa highasjack highhwilk hipstaaaron hoee-no holdyourkite holy-johnson holymagcon horanforhemmings hornyespinosa hornyjacks http-caniff idiothayes i-reallywantfood im-satansdaughter imaginexox itsgrierhayes itsmaryespinosa

J-K
jackedupmendes jackgilinskywhores jackjsbae jackmysammy jackthatmendes ( jacobsmutsides aka jacobs girlfriend ) jacobvsgrier jacubzwhitesider jakcsgilinsky jessicuhisfab jjsmybae johnsonsmuffins jojoespinosa justgilinskys justamagcongirl kaylabourbeau keepingupwiththegriers king-carpenter kingespinosa kiss-my-nash kissmyasspinosa kiwiwawey kkalifornia-dreamss kobyxgrimm kristendallas

L-M
learn-to-love101 lilkittenclifford literallly-shawn literalnope love-life-magcon lovewithhayesgrier lovingmagcon2 lukeftcliffordd lyricsides
ma-m4dness mag-con-boyz magcon-is-mybae magcon-jas magcon-or-n4hh magcon-sluts magconfrustrations magcvnt majesticmendes mattespinhoesa mattespinosasbae mattespinosatho mattfuckingespinosa matthew-espinosa-tho matthewespinosass matthewfuckmeintheasspinosa matthewilkinson matthewleetbh matthews-milkshake matthewsapplepie mattismysmile matts-booty mattsaurus mattsbuckethat mattsespinosas mattslaughtho mattslays mattslipgloss mattsmoaning mattsnuggleme mattsredunderwear mattswhoreinchurch mendes-be-my-bae mendesbabe mendesbabymomma mendesluts mendessbae mimi-thotsides morelikeespinosa mrsfreakingespinosa muffins4mendes muffinswithshawn munchful muscular-dallas mxttcalxm mydashisnash myespinosa mymagconworld

N-O
nash-outloud nashgrierlel nashsgrier nashty—grier nashty-wilkinson nashtydxllas nashtyforever natemaloleyy niallercakez nineonefuckingone nobodymendes nopenodope nostalgiicx notttom
ohmycaniff ohmydalllas omahababes omahahomies omahajohnson omfgmagcon omqmendes

P-R
perfectlyfine26 pineapplegrier pinneappledallas pottorff-bruh pottorfflybeadles princespinosa princesskaelenespinosa qtwhitesides queenwilkinstoned quesadallas radgriers radicalmahogany rainbowshawn reachtheskyflybeautifulchild ridingmendes

S
s3xualmagc0n sammywilkinslut sammywilknson sammywilks sammywilksprincess sexgodmatt shawnmendesofficial shawnmendestho shawns-sass shawnslay shawnsmile shawnsmirk shawnsmuff shawnsmuffinshop shawnsweed shen-mendez shut-up-and-nash-me siinarella skatemaloley slaymegilinsky slayniff slutspinosa smartassgrier so-down-to-earth-im-in-hell spaceeebound squats4shawn stay-cloudy-caylen suckedshawn suckingshawn svmplify swervingriers

T-U
tacoscameron taylorcatnip taylorsgoodvibes taylorsslut tbhmagcon teacatsbooksalways that-fan-girl-life thatcrazytwerkinbanna the-bromance-is-real thecaniffinator tincandatass too-turnt-espinosa totallyespinosa trapgodmendes ttwerkdallas twerkformemagcon twerkingforhayes tyleroakleyisfuckinghot typical-for-a-girl typicalespinosaa unf-wilkinson

V-W
vine-boys-or-gtfo vineboys69 whiteslides whxteverdallas wilkinso wilkinsons-bae wilky-baby withtaylorcaniff96 wlkinson wtfwilkinson wtvrwhitesides

X-Z
yeet-her-right-in-the-puma
yeet-it-or-beat-it yeetgilinsky yo-mendes zayummhayess

HOLY SHIT THAT TOOK FORVER
I SAT 2 HOURS OMFG
BUT

yeah i love you guys so much!
and thank you to all of you who follow me even though im a loser💙💙

Thank You Guys So Much For 1k , I’m So Happy Right Now! And Yes This Is My ” 1k Follow Forever ” But This Is Like A Personal Thank You To The People In This Follow Forever,  So Yeah! Thanks Babes ! :) xXx 

—————————————————————————————————-

A-

aaroncarpenterrr aaroncarpentertho acidcxlum are-you-that-magcon-kid asslikemattfacelikegilinsky au-palace aubreyxpaigee ayemagconpreferences ayeshawnmendes 

B- 

band-youtube-prefs bangmelikey0urdrums bbyclifford beeznichole bigdickgrier blamecalum blowjacks blurbs5sos buckwilddillon 

C- 

california—kake calumpleasestophood calumxhemmings calvumhood cam-espinosa camdallas-things camdallus camdattasstho cameron-alex-dallas cameronsbeanie camerons-puma cams-enshiladass caniffism cartahstaph carterreynoldsmother cashten climash cliffhourd croutoncat cutelikegrier 

D-

dallascult dallaswifey deez-boyz-or-nah devil-in-those-eyes dillonruppiess dirtypreference doritobrooks doyouphilme drewsland 

E-

ehrwins espi-nosa espinosa-my-nosa euphoriahemmings euphoric-ashton

F-

fallenforbands fangirlconfession fansofshawnmendes flights-to-magcon fuckmehoood funkybudda fxllouthemmings 

G-

gettin-jiggy-wit-5sos gilinskers gilinskuy glowingimagines goofyclifford 

H-

hallelujahespinosa hayespinosaa hemmoes hemmosconda hoe-or-hey holdupmatthew holyviners hoodification hoodjamcalum hoppinrivers hunkyhood hotdamn5sos hot-damn-lucas hotdamnaustralians httphayes 

I-

iconicmendes idiotbabeluke if-you-date-him imagine-preferance-central imagineyouricon imperfectlyperfeimagines irwinsbed itssasspinosabitch iwantashtonirwin

J- 

jackgilinsexy jackgilinskystories jackgismybae 

K-

kanyuckwest kawaiihoods kinggilinsky kingilinsky kinkygilinsky

L-

lilianamc littlesmutneverhurtanyone love-life-magcon lovingmagcon2 lukehemmango lukesbigcock 

M-

magcon-or-nahh magcon-sluts magconexposed magconpizza magconpumas magcons mahotanylox mattespinosatho matthewandgilinsky  morelikemendyas

N- nashfuckingrier nashgriersdick nashgriertho nashturbateimagines nashty-is-perfectxxx nashxgrier nflcalum nineboyz noodleboymichael

O- ohmyirvvin oh-my-mendes our2ndlife-news 

P- partybuckwild perfect5sos pinkhairclifford pnksrock 

R- rainbowshawn 

S- s3xualmagc0n sammywillk sarcasticallyimpaired sexycliffconda shanno85 shawngilinsky shawnsmirk slaylorcaniff slutspinosa smilingdallas smut5sos smuttums smutty5sos smuttyscribbles sucklarryscarrot suptaylorcaniff 

T- taylor-caniffs-bandana taylorcanifflovers taylorcaniffsluts taylorcanifftho taylorsgrandpa tf-is-magcon thedillonrupp themagconfamily thepunkfreak totallyespinosa twerking-for-5sos

U- underashton 

V- vinerboysx vodkaclifford

W- wallflowerclemmings wankerville westsidecalum withtaylorcaniff woahirwin woahtheremagcon 

Y- yolucas yummy5sos1dimagines

Z- zamnbae zayummagcon zouiscity 

# -  1d-5sos-imaginess 26magcon-news 4beautifulstoners 5-secs-of-banging 50shadesoflucas 5seconds-of-all-time-low 5seconds-of-magcon 5sexofsongprefs 5sexonds-of-smut 5sexsofpreferences 5soaumemes 5sos-au-meme 5sos-au-imagines 5sos-smut-only 5sos-smut-world 5sos-writing 5sosblurbs 5sosblurbsandmore 

thank you everyone ! again, this is just blogs i see a lot , or just really enjoy . ily all ! & if someone would like to be added , just ask me , ill check out your blog .  :) xXx bye babes .

Hey guys, I just want to say thank you so much for 1k. I love you guys so much, here’s my follow forever.

420gilinsky

8-8shawn

aaronscarpenter

aaronschapstick

asslikematt

ayeshawnmendes

buckwildtaylor

but-magcon-though

camdallus

camdawgdallas

cameronbae

carterreynoldsmother

cashdarier

cashtbh

dopemendes

eatsleepmacgon

frickmematt

gilinskyisagod

gilinskyslay

gilinskytbh

haaspoobear

hayesbae

holyviners

iconicmendes

ilyshawn

jackgismybae

kinkygilinsky

livespinosa

love-life-magcon

magc0nboys

magconboys-smut

magconboys24-7

magconfessions

magconisliife

magconsexuallfrustarations

magconwat

mattsthebae

mostlymagcon

mysasspinosa

nashgriir

nashleygrierr

nashsdickle

nashtyfourlife

ollieandivy

samwilkinsons

screwyoudallas

shawnsbootyclub

slaydallas

taylor-caniffs-bandana

taylorcaniffsluts

themagconfamily

tooturntespinosa

totallyespinosa

ughviners

woahtheredallas

These are all the blog’s that I absolutely love, sorry if I missed you. Thank you so much for following, liking and reblogging my edits and posts.

Thank you so much for getting me to 800 followers! I appreciate every single one of you so much! So for getting 800 followers, I am going to do a follow forever :) Thank you all xoxox - Allison

IF I FORGOT ANYONE IM SORRY AND I LOVE YOU ALL SO MUCH

gif by espinosa-matthew

A

asslikegilinsky ashletmebangyourdrums asslikemattfacelikegilinsky

B

blownialls bitemedallas blazedmendes

C

camsfave callmecaniff cheekygilinsky camdall-ass callingmendes caniffhugs cashbetch cuddlememagcon cliffords-babe californiamuke callingmendes carpenterbooty caniffyounot cashtoxicated

D

daamnbae

E

espinosaor-nah espi-howboutno-sa espinosa-is-bae

F

frickmeirwin frickdallas fcksdallas fuckingmichael

G

gilinskydaddy

H

hayestbh holy-johnson hornyespinosa  hayess-grierr httpsdallas holyjacks homahaboys

J

jackmysammy johnsonsbae

L

leahxespinosa literalnope lukeftcliffordd

mattswhoreinchurch menduhs magcon-perfect matthewfuckmeintheasspinosa magconslut magconxqueen mattespinosaa muffins4mendes mattyftluke matt-surbation mattsaurus

N

niallrocksmyhemmings nash-outloud nashtymatthew

O

ohsnapsammy omahasexgods ohshitgilinsky

P

pacsuncalum pineapplegrier prettygrier popecaniff

R

rad-gilinsky rockpenguins

S

shen-mendez shawnsmuff shawns-dick scandalouswilk shawnsdarling stonedgilinsky smileygrier shawnsdildo smoshyytaylor shawnsweed shut-up-and-nash-me

T

ttoxicttay taydallas totallyespinosa theofficialdillonrupp tbhjackandjack taylorcaniffsluts taylorftbieber taylorsslut

U

unf-wilkinson

W

woahtheredallas wilkinsonslaugh wilkinstud wammysilk whosgilinsky wilkinslays

Y

yungshawn yeetgilinsky

3

Heyyy! Look who made it to 6k! I was suppose to do this when I hit 5k but I was lazy af and put it off. I needed someone to tell me to do it or I probably would of held this off again so thanks to espinosa-is-bae , I did it!

I’m kinda picky about who I follow so if I follow you, you are like amazing!!

I’ve made a lot of friends from tumblr and I’m pretty sure I have more friends on here than in school! Haha.

All the people I talked to in group chats, (which is about 75% of the blogs tagged here) you all are gucci af! ✌️

I am positive I missed someone that deserves to be on this follow forever, sorry!

***^A lot of people changed their URL so I couldn’t find them and tag them :(***

screwyoudallas camdawgdallas & taylorcaniffsluts: You guys were the first 3 magcon (or whatever our fandom is) blogs I ever followed before I made this account. So because of you three I made this account and I haven’t stopped posting. So thanks!

jackgilinskywhores: I love you but Gilinsky is fucking mine okay, bye. #minijackgilinsky #sidehoe 😏

scarycaniff: So glad were friends and I met you!

idiothayes: You are perfect at poetry! Thanks for helping me a little with my science homework! I gotta A!

thebootysquad: This is the best squad ever lol 😘

Thank you to the people who like and reblog a lot!!!

doseofdopenessxoxo

gilxnsky

virginie47

@Iinrolovesya 

espinosas-cupcake

These are amazing blogs I follow!

#-D

2nashty4u aaroncarpentcute ahoybros  aussiemagcon/omahajohnsonbaesicdallas barakat1818 bartbordelonn basedmendes bigdaddywilk bigdickgrier bitchsides boybnadscamdawgdallas camslutt cash-money-twerk catt-is-bae cheekygilinskydillonyupp

E-G

electricgrier espinohsa espinosa-is-bae espinosarachel espinosas-cupcake espinoshitsherlock espinsoa espisaurusrexx ~ finervinerboys flawlesspinosa fluffy-aaron fuckingviners ~ geekygrier gilinskx gilinskysbutternutdude gilinskyystyles gillnsky gilxnsky girlinsky

H-K

hayestbh highhwilk highsammy hipstaaaron holymagcon holyviners ~ idiothayes ilyshawnmendesjackgilinskysseyebrows jackgilinskywhores jackthatmendes jjsmybae justgilinskys ~  kingespinosa kingilinsky kinkygilinsky

L&M

love-cashew lovingmagcon2 lukeftcliffordd ~ magcon-boys159 magconsluts magconaustatus magconsmut majesticmendes mangohood matthewfuckmeintheasspinosa mattsespinosas mattswhoreinchurch mendespinosabae menduhs mrs-mendes muffinboymendes

N-P

nashgriersdick nashsgrier nashtywilkinson ~ ohmydalllas omaha-kenny omahaboys omahasexgods omahasquad omgviners ~ pineapplegrier popecaniff princess-mendes princewhitesides pumaornah

S

samewilkinson sammmywilk @sammywilkinslut/ashton-smut samswilkinson samwilkinsluts scandalouswilk scarycaniff screwyoudallas sextme-sammywilk shawnmendes shawnmendesofficial shawnmymendes shawnsdallas shawnsmirk skatemaloley smilingdallas strbxmendes suckingshawn sunshinegrier supcamerondallas supcaniffs suptaylorcaniff

T-Y

taylor-caniffs-bandana taylorcaniffsluts taylorsgoodvibes thatmagconblog theaaroncarpenter thebootysquad thedillonrupp themagconfamily theofficialdillonrupp thestarsinourmagcon totallyespinosaunf-wilkinsonvanityfairteen versacecam vineboysthetype ~ weedgilinsky wlkinson wtfwilkinson yeet-it-or-beat-it yeetgilinsky

Lol this took forever but these are the blogs I will follow forever, I love you all!

This is probably my last follow forever because this one took to much effort and I’m a lazy person so…..

eeeeeep okay so i kinda hit 1k a few days ago, but i’m just getting to do a follow forever! thank you all so much for 1k!!! it means so much to me!! i love you all :) 

here are a few of my favorite blogs :)


matthewespinosass, ohmycarpentery0ucantskatewithus, http-caniff, wilkinsonsamm, sammywilkk11, sammywilkinslut, yeetgilinsky, nashtymatthew, justgilinskys, pizza-n-boys,  mattswhoreinchurch, muffins4mendes, mattsaqt, hallelujahespinosa, squats4shawn, darlingmendes, asslikemattfacelikegilinsky, asslikeespinosa, cartahstaph, espinosarachel, espinosoh, cartahyas, pineapplegrier, omahaweed, omahajohnson, shut-up-and-nash-me, jackjohnsuns, girlinsky, ughgilinsky, taylorcannot, taylorsgoodvibes, theofficialdillonrupp, mendeswifey, hayestbh, taylorcaniffsluts, taylor-caniff-twerk-king, bartsmoneyteam, shawnsmuff, shawnsmirk, whiteslides, matt-surbation, kingespinosa, 2cute4me, myespinosa, frickfrackmatt, screwyoudallas, nashty-is-perfectxxx, camdawgdallas, camsbeyonce, camsass, sunshinegilinsky, sunshinegrier, cuddlingmendes, disconnectedjacks, doyougotabea, worshipjacks, highgilinsky, jackthatmendes, jawlinsky, gilinskyweed, callingmendes, blowjacks, voguewilkinson, suckmyasshemmings, cameron-alex-dallas, ahoybros, espi-nosa, totallyespinosa, love-cashew, voguewilkinson, barakat1818, idiothayes, espinsoa

I know it’s a lot, but I suggest you follow all of them!!!!!!!!!!! :)

TYSM AGAIN ILY ALL

Shawn Mendes Imagine for Katie

“So uh..I have something to ask you. And it’s a little different from usual.” Shawn said nervously, and you looked up at him, your eyes big. You had had a crush on your best friend, Shawn, for forever now, but you were too afraid to tell him. You didn’t want to ruin your friendship with him if he didn’t feel the same way.
You two had met back in middle school during a hosted music festival, and you were captivated by him. You both talked afterwards, and things just kind of clicked. Ever since then, you’ve been dying to tell him how you felt, but why jeopardize what you already had? Being best friends with Shawn was enough, wasn’t it?
“Yeah? What is it?”
“Um..would you wanna come over my house tonight?”
“Sure, Shawn. That’s not different from usual, my parents will be fine with it.” You said nonchalantly, doodling on your notepad. You had scratched out the hearts with your and Shawn’s initials in them in hopes he wouldn’t see them.
“No, like..like a date. My parents will be out with my sister and I’ve been meaning to ask you for a while now…” he said, trailing off. You stared at him with wide eyes, and he looked back at you worriedly.
“What? Oh shit, did I just ruin everything? You don’t have to if you don’t want to, we could just hang out-“
“No, I’ll come. I’m just a little surprised, that’s all.”
“Why? You didn’t think I liked you like that?” He asked, blushing a little.
“Well..yeah.”
Shawn laughed and hugged you, telling you he’d pick you up at 5.
When 5 rolled around, you were dressed in a comfy love sleeved shirt in your favorite color and tight skinny jeans. You felt a little underdressed but comfortable, and when he came to pick you up, he was wearing just a plain polo and jeans. He opened the car door for you, helping you into the passengers seat. The drive was quiet, as you both were a little nervous. But as soon as you arrived you felt the knot in your stomach unwind and you two were laughing and joking around like it was any other day.
You both sat on the couch, deciding on what movie to watch and you were strongly against his choice.
“We are not watching that! It’s too gorey, I’ll get sick all over you.” You threatened, and he laughed.
“Well, I’m not watching what you picked. I want something entertaining, not a chick flick.”
You huffed and crossed your arms, feigning anger. He sighed and reached over, and you thought he was going to hug you. Instead, his fingers found the weak spots in your sides and he started tickling you furiously. You shrieked in laughter, begging him to stop.
“Shawn! Shawn stop I can’t br-breathe!” You begged, but he kept going, laughing with you.
You reached around his arms and pressed into his side right where his kidneys were, and he jumped five feet in the air, you swore to God. He yelled out in surprise and fell back, his hands leaving your sides.
“Alright, alright, we’ll call it even. Let’s settle on this.” Shawn said, picking one of your favorite Disney movies and pressing play. You cuddled up next to him, resting your head on his chest. You two always cuddled, but everything felt different now that it was suddenly a date. Everything you did was hesitant but deliberate, and you felt like every move you made was awkward. But Shawn didn’t seem to mind, he was feeling the same way.
You melted into his touch, and his hand came up to rub your back slowly, tracing patterns with his fingers every now and then.
The movie finished, and you both stretched, obviously tired. Then Shawn got up suddenly, a smile wide on his face.
“I almost forgot! Wait right here.” He said, running off behind you. You sat on the couch, playing with the sleeves of your shirt, your stomach flipping.
“I wrote a song for you. I want you to hear it.” He said, holding his guitar. “It’s not very good, and I haven’t finished it yet, but I want you to hear it.”
“Okay.” You said, waiting for him. He started strumming quietly, and sang shakily, his voice echoing in your ears. It was about when he first saw you, in the crowd in the cafeteria while he sang a song at the music festival your school sloppily put together. He sang about how he knew he was in love from the second he saw you, and by the time he finished, you were brought to tears.
He set down his guitar and put an arm around you, kissing you at your temple.
“That was beautiful, Shawn. Just beautiful.”
He blushed. “You should see the girl it’s about.” He said, ducking his head a little. You turned to look at him, taking him in fully. His pretty brown eyes, his soft lips, his fluffy hair. You loved him, every inch of him.
“I love you. A lot.” You said quietly, and he grinned sheepishly.
“I love you too.” He said, bringing a hand up to hold your chin. He tilted your face upwards and kissed you softly, putting years of built-up emotion into it. When you pulled away, you were breathless.
“Wow.” You said, and he nodded in agreement. Then you took hold of his face, kissing him again and he smiled, laughing into it.
The rest of the night was spent kissing and cuddling, and falling in love with your best friend. Shawn was everything that you had ever wanted and more, and sitting next to him, your hand in his and his lips on yours, was more than you could have ever dreamed of having.


Requested by sexypinkpuppies
Also for totallyespinosa and @woah-its-shawnmendes (not tagging?) Here’s a cute Shawn imagine for y’all who didn’t give us a prompt for your imagine!

Like and reblog if you like itttt

PINEAPPLEGRIER'S 1K FOLLOW FOREVER

 

this wouldn’t have happened without you guys! these are some of the many blogs I love so damn much and will follow forever. show them some love if you don’t already! x if I missed anyone I’m so sorry and I’m so fucking thankful for all of you cuties!

adoringnash || asslikegilinsky || baesicmagcon || bigbootymendes || bluecornchip377 || bootyespinosa || camdallus || camdawgdallas || camsbeyonce || cams-slut || caniffmendess || carpenters-eyebrows || cartahstaph || cashbetch || cutiecam || cutegilinskys || dallas-oh || darlingmendes || dillonsbandanapants || dillonyupp || disconnectedjacks || espi-howboutno-sa || espinsoa || finervinerboys || forevernashty || fxckingjohnxon || gilinkslay || gilinskyespxnosa || gnarlygodlinsky || goddamngilinsky || hayessfeelss || holy-johnson || holyshawnmendes || http-caniff || httpsammywilk || jjsmybae || justgetnashty || letsget-nashty || livespinosa || lmfao-magcon || lolwhatsmagcon || magcon-planet || matthewfuckmeintheasspinosa  || matthews-milkshake || mattswhoreinchurch || mimi-thotsides || moaningmagcon || nash-outloud || nashtymatthew || nashtywilkinson || naughtycameron || needacamhug || nostalgic-drvgs || oh-so-nashty || omahasexgods || playfulmendes || sammywilkk11 || sammywilkinslut || scutegilinsky || simplyshawns || slaymewhitesides || smirkingshawn || supagilinsky || supinosa || sweetsorrowgilinsky || talk-nashty-to-me || taylors-corvette || trippymendes || totallyespinosa || tyedyedcaniff || u-nashty || versaceruppism || withtaylorcaniff || xgilinsky || yeetcarpenter || yeetgilinsky || yumgilinskyy || 5secondsofthotsides || 50shadesofcarpenter

shoutout to my very first follower, sweetsorrowgilinsky c: || shoutout to my 1,000th follower, naughtycameron c: || And a final shoutout to every one of my followers that got me to 1K! I love you guys so much and thank yoouuu!! NIGGA WE MADE IT

2

HEY
THANK YOU GUYS SO MUCH FOR FOLLOWING, YOU ARE ALL SO NICE
OK SO I DONT REALLY KNOW HOW TO MAKE ONE OF THESE SO THIS IS PRETTY LAME BUT OH WELL

~ here are some blogs that I really like ~
merster98
totallyespinosa
magc0n-f0rever
iconicmendes
taylorcaniffsluts
itsmagconfanuniverse
love-life-magcon
hayesbae
camdawgdallas
camsass
jackjismybae
iconsmagcon
dimplesam
woahvineguys
caniffism
gilinskytbh
magcock
annatw4eva
magconisliife
thejacksarmy
hoppinrivers
gilinskysjack
magconexposed
magconpositivity
camdattasstho

I’ve most probably forgotten heaps more, :((

anyways, idk how to end this but ily bye

xxxx

HOly Shit 400!

Thnks to everyone who stuck around! Sorry for all the taggy confusion! Its up now!

Dedications;

400: leratiee

The ones who were concerned/nice bout this mixup: lukeicouldbeyourprincess lolurnotmyfaves reachforthestarssx frxakingkarinaaa sexpinosaaaa shawns-muffin-mendes miacali434 and the anon who said i was cute :)

And everyone else!

-

-angela-andrews- -ilyhayes- -bands-are-lifee- 

#

0hhey-beaautiful 13lil-j0die 1dsecondsofmagcon 3ndl3ss-summ3rr 5minutesofsummerblog 5secondsofjohnson 5secondsofmaloley 5secondsoftexting 69wilkinson69

A

a-drop-of-kate a-pentaholics-paradise a-problematic-princess aaroncarpenterbae abean874 addsky10 afluffywaffle agesinski31301 agraceunknown akacookie akhilgandra alicer281 allisoncupcake7 alissa-okay allusernamesichoosearetaken amberray99 anacarolsaantos angel-and-a-devil angelicalaidlaw anninhiliation anotherbookobsessedteenager ansleenix6 anvi-s anya-lily15 asdfghjklcxcxc aussiepizza

B

baby-phoenix banapplena bandtubersxtroyler bangingaaron be-immortals beandipp17 bernadettenordahl bethelifeofmyparty bibim00 blazing-world bmth1230 boo-to-society booksmusicandsoup brianamc1214 briannaweimer briiaannaaaaa brittanyy—nicolee buttonbadgesbitches 

C

c-jewell-m caitlinmaree15 calilifewannabe call-me-jords-pls camdattasstho camgrierbaby caross30 cashewjj cashmash5sos cassadilla1418 casuallykeenbeard123 ccluber chalupa-batman1 champagnegilinsky chipsrdabae coff3e-and-cigarett3s colorfulgrier connie-yew cool-sory-bro curious—minds—wonder—alike

D

damn1thood datmagcon-squad dem-imagines-tho depressedxcali destiiinnymariee dignitydallas diioonnaa123 dillion—hemmings96 dinosaurmattchew dont-wait-until-its-gone dopexgilinsky dreamingintheclouds34 drunkaaron dynamicmaria

E

ecec17 elegantlydisfunctional emilylosee11 erenymathers erinkgreen eroticmendes evanescentarcadia everythingwillburn99 eye-rolled-hard eyebrows-on-gilinsky-tho eyebrows-gilinsky

F

f-a-d-e-d-love falll-for-your-type ferir5er fiftyshadesoftheamazingemily fiftyshadesofgilinsky flight-the-fight florenceivy fluffy-aaron fluorescentpizza foodmusicboys frxakingkarinaaa fvckbltchesgetmoney fvckmemendes fxckboydallas

G

g-i-l-i-n-s-k-y gamergirl205 gangbangedshawn gaozongyang27love gilinskiano gilinskiing gilinskysbumm gilliansheaa gipepe green-protein grierismydrug grindlinsky guh-lin-skee21

H

happylittlenash haugen-ella hedrsalcedoo hellanate @hercupcaketaco holygrier horanxfood hufflepuffs-heir hulagurlkc97 humaninahumanworld 

I

i-am-alpha-now i-love-niall-horan- i-nduratized iamnateslilmama id-rather-b-at-coachella idkkcalum ilikenightwriting ilikeantoinette ilove27pears imagineblr imaginesfromthemaze imbreakingintopieces impossiblynoisywasteland incommonpandabanana inktornados it-gets-better—i-promise itsdrea330 itskimberleymartin itsleviosanotleviosah-godron itstrueloveforthemagconboys

J

jackgakaloml jackgilinskisbae jackgilinskysgal jackjohnsonssass jacksoffcial jackxgilinskyy jadforever jamiedbaker jayc-ee jazzyalexandria jewlyann14 josieee10 juliana872 justyoumeanddylan just-anotherprettyface justanotherdumbbandimagineblog justfuckmyurl justkimz12 jxmesgrxhxm 

K

kailawashere karoliinaaaah kat1511 katelou69 katie-dallas-mendes katskrachiz kaylavolkes kayxshelton kennedy-baxter kenziepedersen1 killer-bitch-101 kiss-my-sass-ya-bisssh koawalla kuwtomahaboys

L

lauryntatertot layawayseason leratiee letsgodontleavemeplease lexieliz lifeofnayeli lilirain lilycordero lisha-braynt literalnope literallyimawkward littl3d3monicf4eprinc3 little-misunderstood-soul lolaaaaaaaaaaa1d lolurnotmyfaves lookingformatt love-sports-food lovely-mendes lrhslipring lukeicouldbeyourprincess

macylux mag-con-boyz magcon-imagines1 magcon-omahasquad magconboysmuffinxx magconimaginess makemukesloveaffairrain maleuhh maliceincandyland maloleyfeels maloleysass marriedtothemusic16 marvel-ous-heroes matthewxmagcon mazyam mcmaloley meetyourpsychiccom mellowmendes mendesco mendesgilinskydallas mendeslover miacali434 michele-lancaster mickeynov123 milly5soslover mirandacoaster miss-rissa967 misshusnaali moneyweedzayn motherfckinfandoms muffinmyshawn myfuckingsummertime mztella

N

n0nexistentj0yland nanamonkey156 nashgrierisbae1 nashty-but-she-fancy natasha05000 nate-maloley564 natesass-ets natesbabe1998 neci-pooh newlifestartnow newtafthomassangster nici-like-nikki no-it-girl no-lol-jk ntwinzyvy 

O

obscuredreams17 ohmyallypinckney olivia-victoriad oliviacunningham5 omaha-beauties omaha-sos omahaagad omahaparadise omahasquad-af omahasquad-o2l-magconfessions omahawildflower onelove14xx 

P

patrickstumpspants paustylesxx permaculturerainbows perrie96st petersqueaker pimp-daddy-jack pizzaandhemmings pladluke pleasgoaway plutophobic poochfucker popecaniff princesss-sammy purpleluver78

Q

queenopitch9 queenparxdise

R

ravenclawinabluebox reachforthestarssx reubenstephan ridingilinsky robynhamilton rosegoldlox

S

safetrekapp sammywilkme sanelyinlove sarahcrxss sassysirah scottish-hugs-for-troyler sexpinosaaaa shaishaibae shawn-sammy-skate-slut shawnbbymendes shawnmendesstolemyheart shawns-cutie shawns-muffin-mendes shawnsdildo shyawn sideways-snapback silly-me-123 sjeagles sk8ergirl9 skinnyminne1 slaywilkinson slayshawn sleep-and-dance slothpadawan slowlyuniquefan slytherhoesunite smutgilinsky socialkingmaker solkiewicz somethingpoetichere sort-of-pretty-in-pink spencerhood spencerismyspiritanimal standandfacetheunknown starbucksgilisnkypost staysmurfy-cx stephanie117101 stonednatee stories-5sos studiodays stuntingjacks suckfienfd summerregi243 supportmendes suptaylorcaniff sweetgrierdallas sz3r3tl3k

T

taylorsquxxn teenage-nightamre tensgirl99 thanksbeto-castiel that-syydkiid the-youtuber-phandom thecoolkidz543 thecreepiestfangirl themadhatterandmarchhare theresjust-onlytreehill thesarcasticpotato thorneftwhitesides those9viners thoseffingmagconboys tiedye-luke tits-migits totallyespinosa troyesgeekygirl trulymeblog twinharlee14 tyler120

U

ughmaloley ukulelucas ultr-av-iolent ummaloley unholynatemaloley unprofess

V

vacccinates versacemaloley vinyl-hood

W

wammysilk watercolor-wonders whateverbabeslove whitesidesbabee whoa-edits whosjnast why-dididothis wickdbitchofthewest wilkinskate wilkmygilinsky wishuwerehere1 wnxnhltlwzbjckvlgendbjcg woeitsshana

X

x-handwritten-x xo08xo28 xxxflowergirllxxx

Y

ya-might-as-well yami-biersack yes-homie yessomahotties yolo13ya14 youcanbedaddy youtubers-are-life-ruiners

Z

zouisyass zestywaterhorse

Thank you to everyone who stuck since they followed me! 

I hope everyone has a happy Easter (or spring if you’re not christian)!

I am requesting everyone to not request imagines right now. im pretty fulL.

IF ANYONE IS SICK OF THIS TAG THING, TELL ME. YOUR NAME WILL STILL BE ONE HERE, JUST NOT @’D.

thanks again!

love,

Jackie